SLC22A24 Polyclonal antibody, PBS Only

• 

  WB analysis using 20834-1-AP (same clone as 20834-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20834-1-AP (SLC22A24 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20834-1-PBS in a different storage buffer formulation.

SLC22A24 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20834-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20834-1-PBS targets SLC22A24 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14907

  Product name: Recombinant human SLC22A24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-156 aa of BC034394

  Sequence: MGFDVLLDQVGGMGRFQICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDSVSDNDTGTLSKDDLLRISIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSSFLSTIVTEWDLVCESQSLKSMVQSLFMAGS

• Full Name: solute carrier family 22, member 24
• Calculated Molecular Weight: 322 aa, 36 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC034394
• Gene Symbol: SLC22A24
• Gene ID (NCBI): 283238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N4F4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC22A24, an orphan transporter, belongs to the SLC22 family, which transports organic ions. SLC22A24 is conserved among higher order primates, but has diverged within lower level primates and other mammals.