Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IHC detected in | human liver cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 2 publications below |
Product Information
27998-1-AP targets SLC22A9 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27573 Product name: Recombinant human SLC22A9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-175 aa of BC022379 Sequence: HILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDSSRVGNT Predict reactive species |
| Full Name | solute carrier family 22 (organic anion transporter), member 9 |
| Calculated Molecular Weight | 553 aa, 62 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC022379 |
| Gene Symbol | SLC22A9 |
| Gene ID (NCBI) | 114571 |
| RRID | AB_2881034 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IVM8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC22A9 antibody 27998-1-AP | Download protocol |
| WB protocol for SLC22A9 antibody 27998-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Drug Dev Res The mechanism of Arhalofenate in alleviating hyperuricemia-Activating PPARγ thereby reducing caspase-1 activity. | ||
Behav Brain Res Disorders in the gut and liver are involved in depression contagion between isosexual post-stroke depression mice and the healthy cohabitors | ||
J Ethnopharmacol The Impact of Chrysanthemi Indici Flos-Enriched Flavonoid part on the Model of Hyperuricemia Based on Inhibiting Synthesis and Promoting Excretion of Uric Acid |









