SLC25A12 Monoclonal antibody, PBS Only (Detector)

SLC25A12 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 67467-1-PBS
Clone No.1F2B10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

AGC1, Araceli hiperlarga, Aralar, Aralar1, Electrogenic aspartate/glutamate antiporter SLC25A12, mitochondrial

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67467-1-PBS targets SLC25A12 as part of a matched antibody pair:

MP50650-2: 67467-4-PBS capture and 67467-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13576

Product name: Recombinant human SLC25A12 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 326-678 aa of BC016932

Sequence: SAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGLYKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ

Predict reactive species
Full Name solute carrier family 25 (mitochondrial carrier, Aralar), member 12
Calculated Molecular Weight 75 kDa, 63 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC016932
Gene Symbol SLC25A12
Gene ID (NCBI) 8604
RRIDAB_2882696
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75746
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC25A12, also known as ARALAR1, is a key component of the malate-aspartate shuttle, a metabolic system that facilitates the transfer of reducing equivalents (NADH) from the cytoplasm into mitochondria, thereby supporting oxidative phosphorylation and ATP production. SLC25A12 dysfunction results in impaired mitochondrial energy production, which can lead to neuronal damage, developmental delays, and myelination defects (PMID: 20015484).

Loading...
||
New chat

Able

正在加载,请稍候...