• Featured Product
  • KD/KO Validated

GLUT1 Polyclonal antibody

GLUT1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 21829-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ChIP, ELISA

SLC2A1, SLC2A1,GLUT1, GLUT-1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled HT-29 cells, 37°C incubated mouse colon tissue
Positive IHC detected inrat brain tissue, human lung cancer tissue, human cervical cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

For optimal WB detection with 21829-1-AP, we recommend to avoid boiling the sample after lysis.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)-PIF-P : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21829-1-AP targets GLUT1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, goat, lasiopodomys brandtii
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16282

Product name: Recombinant human SLC2A1,GLUT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 216-280 aa of BC121804

Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 1
Calculated Molecular Weight 492 aa, 54 kDa
Observed Molecular Weight 45-55 kDa
GenBank Accession NumberBC121804
Gene Symbol GLUT1
Gene ID (NCBI) 6513
RRIDAB_10837075
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP11166
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucose transporter 1 (GLUT1), also known as solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), is a uniporter protein responsible for the transport of glucose in many cell types and across the blood-brain barrier.

What is the molecular weight of GLUT1? Is GLUT1 post-translationally modified?

There are two forms of GLUT1 transporter that differ in their molecular weight. The 45-kDa form is found in glial cells, while the 55-kDa form is present in the endothelial cells regulating glucose transport over the blood-brain and blood-tissue barriers (PMID: 9630522). N-glycosylation of asparagine at position 42 is the only known post-translation modification of GLUT1 (PMID: 3839598).

What is the subcellular localization of GLUT1?

Glucose transporters, including GLUT1, are multiple-pass integral membrane proteins. GLUT1 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes.

What molecules can be transported by GLUT1?

The main substrate of GLUT1 transport is glucose, but it can also transport galactose, mannose, glucosamine, and reduced ascorbate.

What is the tissue expression pattern of GLUT1?

GLUT1 is expressed by many cell types but the highest levels are observed in erythrocytes and in the central nervous system (astrocytes). GLUT1 is responsible for glucose transfer across the blood-brain and blood-tissue barriers, including placental transport.



Protocols

Product Specific Protocols
WB protocol for GLUT1 antibody 21829-1-APDownload protocol
IHC protocol for GLUT1 antibody 21829-1-APDownload protocol
IF protocol for GLUT1 antibody 21829-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Adv Mater

Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration

Authors - Zhuo Li
humanWB

Cancer Cell

Transcriptional Regulation of the Warburg Effect in Cancer by SIX1.

Authors - Ling Li
mouseWB,IHC

Int J Oral Sci

Transcriptional activation of glucose transporter 1 in orthodontic tooth movement-associated mechanical response.

Authors - Yu Wang
mouseIF

ACS Nano

Biomimetic Nanomedicine Targeting Orchestrated Metabolism Coupled with Regulatory Factors to Disrupt the Metabolic Plasticity of Breast Cancer

Authors - Lingtong Meng
humanWB

Nat Commun

Parvimonas micra promotes oral squamous cell carcinoma metastasis through TmpC-CKAP4 axis

Authors - Houbao Qi
mouseIF

Neuron

Sympathetic nerve-enteroendocrine L cell communication modulates GLP-1 release, brain glucose utilization, and cognitive function

Authors - Wenran Ren

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marco (Verified Customer) (07-04-2024)

Nice Westernblots in NRVCMs

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: NRVCMs
FH

Hua (Verified Customer) (02-14-2023)

Good antibody working for WB with mouse liver samples. However, boiling mouse colon and brain tissues results in no band observed.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: mouse liver, brain, and colon
GLUT1 Antibody Western Blot validation (1:4000 dilution) in mouse liver, brain, and colon (Cat no:21829-1-AP)
FH

William (Verified Customer) (10-26-2021)

Very clear staining in IHC in rat brain tissue (Wistar) at a concentration of 1:100, very well localised to blood vessels. Not tested yet at different concentrations

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Rat brain
FH

Bastien (Verified Customer) (08-19-2020)

Staining of B cells from mice bone marrow after cytoplasmic permezbiliation. The cells were first fixed and permeabilized with intracellular fix and perm set from ebioscience and then stained with 1 µl/ million cells with Glut-1 antibody (21829-1-AP) during 50min After, a seconde staining was performed with 0,1µl/million cells of F(ab')2-Donkey anti-Rabbit IgG (H+L), PE, Secondary Antibody from invitrogen. In blue secondary antibody alone and in red primary (21829-1-AP) +secondary antibody

  • Applications: Flow Cytometry
  • Primary Antibody Dilution: 1µl/10^6cells
  • Cell Tissue Type: B cells
GLUT1 Antibody Flow Cytometry validation (1µl/10^6cells dilution) in B cells (Cat no:21829-1-AP)
FH

Susan (Verified Customer) (11-19-2019)

20ug of HeLa cells overexpressing Glut1-GFP. Blocked with 5% milk in 0.1% TBST and incubated overnight at 4 degrees with rocking.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HeLa
GLUT1 Antibody Western Blot,Immunofluorescence, validation (1:2000 dilution) in HeLa (Cat no:21829-1-AP)
FH

Kishor (Verified Customer) (12-13-2018)

I got good results in cultured cells but I could not see any results with rat liver protein.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: H69, HUCCT-1
Loading...