SLC2A12 Polyclonal antibody, PBS Only

• 

  WB analysis using 26958-1-AP (same clone as 26958-1-PBS)

  Boiled and unboiled mouse heart tissue were subjected to SDS PAGE followed by western blot with 26958-1-AP (SLC2A12 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 26958-1-AP (same clone as 26958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 26958-1-AP (SLC2A12 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 26958-1-AP (same clone as 26958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 26958-1-AP (SLC2A12 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26958-1-PBS in a different storage buffer formulation.

SLC2A12 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26958-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26958-1-PBS targets SLC2A12 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24979

  Product name: Recombinant human SLC2A12 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 550-617 aa of BC070149

  Sequence: PETKGCSLEQISMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLECNKLCGRGQSRQLSPET

• Full Name: solute carrier family 2 (facilitated glucose transporter), member 12
• Calculated Molecular Weight: 617 aa, 67 kDa
• Observed Molecular Weight: 67-70 kDa
• GenBank Accession Number: BC070149
• Gene Symbol: SLC2A12
• Gene ID (NCBI): 154091
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TD20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC2A12 encodes glucose transporter type 12 (GLUT12), a basal and insulin-independent glucose transporter in the heart with previously reported associations with idiopathic dilated cardiomyopathy in humans, as well as insulin resistance and kidney disease in animal models (PMID: 37081215).