• Featured Product
  • KD/KO Validated

GLUT2 Polyclonal antibody

GLUT2 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 20436-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, ELISA

GLUT-2, SLC2A2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, mouse kidney tissue, HEK 293 cells, HepG2 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue
Positive IP detected inmouse kidney tissue
Positive IHC detected inmouse pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20436-1-AP targets GLUT2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, sheep, lasiopodomys brandtii
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14204

Product name: Recombinant human SLC2A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 69-128 aa of BC060041

Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 2
Calculated Molecular Weight57 kDa
Observed Molecular Weight 60-70 kDa, 38-45 kDa
GenBank Accession NumberBC060041
Gene Symbol GLUT2
Gene ID (NCBI) 6514
RRIDAB_2750600
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP11168
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucose transporter 2 (GLUT2), also known as solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2), is a transporter protein regulating glucose transport across cell membranes in an insulin-independent manner.

 

What is the molecular weight of GLUT2? Is GLUT2 post-translationally modified?

GLUT2 can be N-glycosylated. The molecular weight of mature glycosylated GLUT2 transporter is between 55 and 65 kDa, but a minor 38-kDa form is often detected in hepatocytes that may represent a non-glycosylated or proteolytic product (PMID: 12101013).

 

What is the subcellular localization of GLUT2?

Glucose transporters, including GLUT2, are multiple-pass integral membrane proteins. GLUT2 is present at the plasma membrane but has also been reported to be present at intracellular membranes, including the endoplasmic reticulum (PMID: 12101013).

 

What molecules can be transported by GLUT2?

Although the main substrate of GLUT2 transport is glucose, it can also transport galactose, mannose, and fructose.

 

What is the tissue expression pattern of GLUT2?

GLUT2 is expressed in many cell types. High expression of GLUT2 is observed in hepatocytes, where GLUT2 mediates glucose uptake and release regulating glucose levels in blood, in intestinal cells, where it regulates glucose transport at the basolateral membrane and to a lesser extent from the apical membrane, and in the kidney proximal tubule, where it is involved in glucose reabsorption and is present at the basolateral membrane.


Protocols

Product Specific Protocols
IHC protocol for GLUT2 antibody 20436-1-APDownload protocol
IP protocol for GLUT2 antibody 20436-1-APDownload protocol
WB protocol for GLUT2 antibody 20436-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

ACS Nano

PMID: 30052036

Authors - Yaoxiang Sun
ratIHC

Nat Commun

Partial freezing of rat livers extends preservation time by 5-fold

Authors - Shannon N Tessier
humanWB

Clin Transl Med

USP7 promotes non-small-cell lung cancer cell glycolysis and survival by stabilizing and activating c-Abl

Authors - Yuanming He
mouse,humanWB

Cell Mol Gastroenterol Hepatol

Patient-Derived Mutant Forms of NFE2L2/NRF2 Drive Aggressive Murine Hepatoblastomas.

Authors - Huabo Wang
mouseWB

Mol Metab

T1R2 receptor-mediated glucose sensing in the upper intestine potentiates glucose absorption through activation of local regulatory pathways.

Authors - Kathleen Smith
mouseIF

Metabolism

Rheb1 promotes glucose-stimulated insulin secretion in human and mouse β-cells by upregulating GLUT expression.

Authors - Yan Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Vignesh (Verified Customer) (09-15-2025)

results are excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HTR cells
FH

Balawant (Verified Customer) (07-25-2022)

This antibody I used and it is working great. I will recommend this antibody for Immunoblting.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: Caco2 cell and colon tissue
FH

Susmita (Verified Customer) (04-13-2022)

This antibody is working nicely for my WB

  • Applications: Western Blot
  • Primary Antibody Dilution: WB: 1: 1500
FH

Boyan (Verified Customer) (08-24-2021)

Not conclusive. This antibody primarily recognized a band at ~ 90 kd, which did not respond to a Glut2 siRNA treatment. It also weakly recognized a band at ~ 70 kd, which responded to de-glycosylation treatment.

  • Applications: Western Blot
FH

Iram (Verified Customer) (09-17-2020)

Excellent GLUT-2 Antibody. Giving a very good results for WB and IF.

  • Applications: Western Blot, Flow Cytometry
  • Primary Antibody Dilution: 1:2000 for western and 1:200 for IF
  • Cell Tissue Type: Human colon cancer
FH

Pradeep (Verified Customer) (09-17-2020)

Very good antibody for western blot. I checked in INS-1 cell line.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: INS-1
Loading...
||
New chat Able
正在加载,请稍候...