Tested Applications
| Positive IHC detected in | mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31182-1-AP targets SLC2A7 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34515 Product name: Recombinant human SLC2A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-281 aa of NM_207420 Sequence: PESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLR Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 7 |
| Calculated Molecular Weight | 512 aa, 56 kDa |
| GenBank Accession Number | NM_207420 |
| Gene Symbol | SLC2A7 |
| Gene ID (NCBI) | 155184 |
| RRID | AB_3669886 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6PXP3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC2A7 (solute carrier family 2 member 7, also known as GLUT7) belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC2A7 antibody 31182-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

