SLC35A3 Polyclonal antibody

SLC35A3 Polyclonal Antibody for WB, ELISA

Cat No. 26874-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Golgi UDP GlcNAc transporter, NGT, SLC35A3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis using 26874-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 26874-1-AP (SLC35A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 26874-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 26874-1-AP (SLC35A3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

HeLa cells, HEK-293 cells, HepG2 cells, LNCaP cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26874-1-AP targets SLC35A3 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag25468 Product name: Recombinant human SLC35A3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 158-220 aa of BC005136 Sequence: SDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL Predict reactive species
Full Name	solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3
Calculated Molecular Weight	325 aa, 36 kDa
Observed Molecular Weight	32-36 and 41 kDa
GenBank Accession Number	BC005136
Gene Symbol	SLC35A3
Gene ID (NCBI)	23443
RRID	AB_2880665
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y2D2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC35A3, also named as UDP-N-acetylglucosamine transporter(NGT), is located to the Golgi apparatus. SLC35A3 can form heterologous complexes with SLC35A2(UGT) and Mgats in the Golgi membrane which may promote biosynthesis of complex N-glycans. It has been reported that the mutation of SLC35A3 is associsted with skeletal dysplasia and epilepsies which could result from impaired glycosylation of proteins. SLC35A3 has some isoforms with 32-36 kDa and 41 kDa.(PMID: 25944901, 28777481 , 16344554, 23583405)