Product Information
20468-1-AP targets SLC37A3 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14305 Product name: Recombinant human SLC37A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 218-307 aa of BC046567 Sequence: AGGIVIFFGLLVSPEEIGLSGIEAEENFEEDSHRPLINGGENEDEYEPNYSIQDDSSVAQVKAISFYQACCLPGVIPYSLAYACLKLVNY Predict reactive species |
| Full Name | solute carrier family 37 (glycerol-3-phosphate transporter), member 3 |
| Calculated Molecular Weight | 494 aa, 54 kDa |
| GenBank Accession Number | BC046567 |
| Gene Symbol | SLC37A3 |
| Gene ID (NCBI) | 84255 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8NCC5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
