Product Information
21287-1-PBS targets SLC39A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15807 Product name: Recombinant human SLC39A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 61-175 aa of BC096723 Sequence: FMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFLVFFLESLALQCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFH Predict reactive species |
| Full Name | solute carrier family 39 (zinc transporter), member 2 |
| Calculated Molecular Weight | 309 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa, 66-70 kDa |
| GenBank Accession Number | BC096723 |
| Gene Symbol | SLC39A2 |
| Gene ID (NCBI) | 29986 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NP94 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC39A2 (hZIP2) is a human zinc importer in the ZIP family, which is essential in the maintenance of intracellular zinc homeostasis and is upregulated by zinc depletion. SLC39A2 is highly expressed in prostate epithelial cells and is involved in prostate cancer development. Most SLC39 proteins consist of eight transmembrane domains (TMDs), with extracellular or intravesicular amino and carboxy termini (PMID: 34790705). Zip2 gene knockout exacerbated myocardial I/R injury, whereas Zip2 gene transfer reduced myocardial infarction (PMID: 31095941). The predicted molecular weight of SLC39A2 is 33 kDa, and a band of dimers at 66 kDa can also be detected by this antibody (PMID: 24619115).









