Band 3/AE 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Band 3/AE 1 Polyclonal antibody (28131-1-AP)

Band 3/AE 1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 28131-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

band 3, band 3/ AE1, SLC4A1, AE 1, AE1

• 

  WB analysis of mouse liver using 28131-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 28131-1-AP (band 3/ AE1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 28131-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 28131-1-AP (band 3/ AE1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 28131-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 28131-1-AP (SLC4A1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 28131-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28131-1-AP (band 3/ AE1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 28131-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28131-1-AP (band 3/ AE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 28131-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 28131-1-AP (band 3/ AE1antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 28131-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human placenta tissue using band 3/ AE1 antibody (28131-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 28131-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human placenta tissue using band 3/ AE1 antibody (28131-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Band 3/AE 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COLO 320 cells, mouse liver tissue
• Positive IHC detected in: human spleen tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28131-1-AP targets Band 3/AE 1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27878

  Product name: Recombinant human SLC4A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC101570

  Sequence: MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF

• Full Name: solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
• Calculated Molecular Weight: 911 aa, 102 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC101570
• Gene Symbol: band 3
• Gene ID (NCBI): 6521
• RRID: AB_2881069
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02730
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Anion exchanger 1 (AE1), also known as band 3, is a 95-100 kDa transmembrane glycoprotein which is abundantly expressed in erythrocyte plasma membrane and mediates the electroneutral exchange of Cl- and HCO3-. It contains a 52-55 kDa C-terminal membrane crossing domain and a 43 kDa N-terminal cytoplasmic domain. Degradation of band 3 protein occurred during erythrocyte aging. The oxidative stress can also activate the proteolysis of band 3 through caspases.

Publications

What published studies show

Anti-Band 3 (ANK1) antibody, catalog number 28131-1-AP, has 12 citations appearing in journals including Cell Stem Cell, Neuron, Molecular Cell, Journal of Clinical Investigation, Phytomedicine, Cell Reports, NPJ Regenerative Medicine, International Journal of Molecular Sciences, Annals of Hematology, International Journal of Hematology, and eLife. Research fields span hematopoietic stem cell biology, blood-brain barrier, skeletal muscle pathology, allergic rhinitis, hepatocellular carcinoma, erythroblast maturation, ovarian cancer, hereditary spherocytosis, and red blood cell physiology.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Stem Cell; SDHAF1 confers metabolic resilience to aging hematopoietic stem cells by promoting mitochondrial ATP production; Authors - Shintaro Watanuki
mouse	IHC	Neuron; Single-cell dissection of the human blood-brain barrier and glioma blood-tumor barrier; Authors - Yuan Xie
human	WB	Mol Cell; The mTORC1-SLC4A7 axis stimulates bicarbonate import to enhance de novo nucleotide synthesis.; Authors - Eunus S Ali
Mouse	WB	J Clin Invest; Impaired hydrogen sulfide biosynthesis underlies eccentric contraction-induced force loss in dystrophin-deficient skeletal muscle; Authors - W Michael Southern
human	IF	Phytomedicine; Trans-resveratrol mitigates miR-204-3p mediated progression of allergic rhinitis by regulating the EGLN3/HIF-1α/IL33/ST2 signalling pathway; Authors - Wei Mao
human	WB	Cell Rep; Carbonic anhydrase 2 facilitates sorafenib resistance by counteracting MCT4-mediated intracellular pH dysregulation in HCC; Authors - Hui Lu