Band 3/AE 1 Polyclonal antibody

• 

  WB analysis of HepG2 using 18566-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18566-1-AP (band 3 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse liver using 18566-1-AP

  IP result of anti-Band 3/ AE1 (IP:18566-1-AP, 4ug; Detection:18566-1-AP 1:300) with mouse liver tissue lysate 4000ug.

• 

  IHC staining of human spleen using 18566-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18566-1-AP (band 3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 18566-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 18566-1-AP (band 3 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 18566-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18566-1-AP (band 3 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 18566-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 18566-1-AP (band 3 antibody at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human stomach cancer using 18566-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 18566-1-AP (band 3/ AE1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 18566-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 18566-1-AP (band 3/ AE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 18566-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human placenta tissue using band 3/ AE1 antibody (18566-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human placenta using 18566-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human placenta tissue using band 3/ AE1 antibody (18566-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

Band 3/AE 1 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 18566-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

band 3, band 3/ AE1, SLC4A1, Band 3 anion transport protein, Anion exchanger 1

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human spleen tissue, human stomach cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

18566-1-AP targets Band 3/AE 1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, plasmodium falciparum
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13076

  Product name: Recombinant human SLC4A1 protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-353 aa of BC101570

  Sequence: MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAK

• Full Name: solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
• Calculated Molecular Weight: 911 aa, 102 kDa
• Observed Molecular Weight: 95 kDa, 50 kDa
• GenBank Accession Number: BC101570
• Gene Symbol: band 3
• Gene ID (NCBI): 6521
• RRID: AB_10642570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02730
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Anion exchanger 1 (AE1), also known as band 3, is a 95-100 kDa transmembrane glycoprotein which is abundantly expressed in erythrocyte plasma membrane and mediates the electroneutral exchange of Cl- and HCO3-. It contains a 52-55 kDa C-terminal membrane crossing domain and a 43 kDa N-terminal cytoplasmic domain. Degradation of band 3 protein occurred during erythrocyte aging. The oxidative stress can also activate the proteolysis of band 3 through caspases. This antibody is expected to recognize the intact band 3 (95-100 kDa) and various degradation products (38-60 kDa). (PMID: 22890269, 29240292, 28130418)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Blood; Ferroportin deficiency in erythroid cells causes serum iron deficiency and promotes hemolysis due to oxidative stress.; Authors - De-Liang Zhang
mouse	WB	Sci Adv; Red blood cell-derived nanoerythrosome for antigen delivery with enhanced cancer immunotherapy.; Authors - Xiao Han
mouse,human	WB	J Proteome Res; Proximity Proteomics Has Potential for Extracellular Vesicle Identification.; Authors - Hisako Kaneda
human	IF	Stem Cells Int; Pyridoxal-5'-Phosphate Promotes Immunomodulatory Function of Adipose-Derived Mesenchymal Stem Cells through Indoleamine 2,3-Dioxygenase-1 and TLR4/NF-κB Pathway.; Authors - Cong Li
rat	IHC	PLoS One; Mechanisms that determine the internal environment of the developing brain: a transcriptomic, functional and ultrastructural approach.; Authors - Liddelow Shane A SA
rat	IHC	Front Neurosci; Influx mechanisms in the embryonic and adult rat choroid plexus: a transcriptome study.; Authors - Norman R Saunders