SLC5A8 Polyclonal antibody, PBS Only

SLC5A8 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 29827-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Sodium-coupled monocarboxylate transporter 1, Sodium iodide-related cotransporter, SMCT1, SMCT, Apical iodide transporter

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

29827-1-PBS targets SLC5A8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30183

Product name: Recombinant human SLC5A8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 461-518 aa of BC110492

Sequence: QIYPPLPERTLPLHLDIQGCNSTYNETNLMTTTEMPFTTSVFQIYNVQRTPLMDNWYS

Predict reactive species
Full Name solute carrier family 5 (iodide transporter), member 8
Calculated Molecular Weight 610 aa, 67 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC110492
Gene Symbol SLC5A8
Gene ID (NCBI) 160728
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N695
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The sodium-coupled monocarboxylate transporter 1 (SMCT1; SLC5A8), belonging to the SLC5A family, is a 67-kDa protein that functions as a Na+-coupled electrogenic transporter for SCFAs. SLC5A mRNA and protein are expressed in healthy human, rat, and mouse colon. The protein is localized to the apical membrane of the colonocytes. Immunohistochemical studies revealed the selective localization of SMCT1 on the brush border in the villi of the terminal ileum and crypts of the colon in mice.

Loading...
||
New chat Able
正在加载,请稍候...