Product Information
25919-1-AP targets SLC6A20 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23194 Product name: Recombinant human SLC6A20 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 487-592 aa of BC136431 Sequence: RRFESDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWDASQGQLVTKDYPAYALAVIGLLVASSTMCIPLAALGTFVQRRLKRGDADPVA Predict reactive species |
| Full Name | solute carrier family 6 (proline IMINO transporter), member 20 |
| GenBank Accession Number | BC136431 |
| Gene Symbol | SLC6A20 |
| Gene ID (NCBI) | 54716 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NP91 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
