Tested Applications
Positive WB detected in | SH-SY5Y cells, RAW 264.7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
29186-1-AP targets Serotonin transporter in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30412 Product name: Recombinant human SLC6A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_001045 Sequence: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVD Predict reactive species |
Full Name | solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 |
Calculated Molecular Weight | 70 aa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | NM_001045 |
Gene Symbol | Serotonin transporter |
Gene ID (NCBI) | 6532 |
RRID | AB_2935471 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31645 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Serotonin transporter (SERT; SLC6A4) belongs to the sodium- and chloride-dependent monoamine transporter family. SERT is a membrane transporter that terminates the neurotransmission of serotonin, a monoaminergic neurotransmitter, through its reuptake. The SERT uptake mechanism acquires energy for active transport via ATP hydrolysis or via movement against electrochemical gradients. As an oligomeric N-glycan, SERT contains disulfide bonds between cysteine residues on the second extracellular domain. Post-translational modifications regulate the uptake kinetics and membrane trafficking of SERT, in part by regulating the proper folding and assembly of SERT in a host-dependent manner (PMID: 30394319).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Serotonin transporter antibody 29186-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |