Serotonin transporter Polyclonal antibody

• 

  WB analysis using 29186-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29186-1-AP (Serotonin transporter antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Serotonin transporter Polyclonal Antibody for WB, ELISA

Cat No. 29186-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

SLC6A4, 5 HTT, 5 HTTLPR, 5HTT, hSERT

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29186-1-AP targets Serotonin transporter in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30412

  Product name: Recombinant human SLC6A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of NM_001045

  Sequence: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVD

• Full Name: solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
• Calculated Molecular Weight: 70 aa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001045
• Gene Symbol: Serotonin transporter
• Gene ID (NCBI): 6532
• RRID: AB_2935471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P31645
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serotonin transporter (SERT; SLC6A4) belongs to the sodium- and chloride-dependent monoamine transporter family. SERT is a membrane transporter that terminates the neurotransmission of serotonin, a monoaminergic neurotransmitter, through its reuptake. The SERT uptake mechanism acquires energy for active transport via ATP hydrolysis or via movement against electrochemical gradients. As an oligomeric N-glycan, SERT contains disulfide bonds between cysteine residues on the second extracellular domain. Post-translational modifications regulate the uptake kinetics and membrane trafficking of SERT, in part by regulating the proper folding and assembly of SERT in a host-dependent manner (PMID: 30394319).