SLC7A10 Recombinant monoclonal antibody, PBS Only (Detector)

SLC7A10 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83072-2-PBS
Clone No.230400C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

ASC1, Asc-1, Asc-type amino acid transporter 1, Solute carrier family 7 member 10

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83072-2-PBS targets SLC7A10 as part of a matched antibody pair:

MP00053-1: 83072-3-PBS capture and 83072-2-PBS detection (validated in Cytometric bead array)

MP00053-2: 83072-1-PBS capture and 83072-2-PBS detection (validated in Cytometric bead array)

MP00053-3: 83072-4-PBS capture and 83072-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34628

Product name: Recombinant human SLC7A10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 469-523 aa of BC035627

Sequence: WRSKPKCVHRLTESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ

Predict reactive species
Full Name solute carrier family 7, (neutral amino acid transporter, y+ system) member 10
Calculated Molecular Weight 57 kDa
GenBank Accession NumberBC035627
Gene Symbol SLC7A10
Gene ID (NCBI) 56301
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NS82
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...