SLC7A7 Polyclonal antibody

• 

  WB analysis using 26403-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26403-1-AP (SLC7A7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

SLC7A7 Polyclonal Antibody for WB, ELISA

Cat No. 26403-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

LAT3, LPI, Monocyte amino acid permease 2, MOP 2, Y+L amino acid transporter 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse kidney tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26403-1-AP targets SLC7A7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23872

  Product name: Recombinant human SLC7A7 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 459-511 aa of BC010107

  Sequence: LIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
• Calculated Molecular Weight: 511 aa, 56 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC010107
• Gene Symbol: SLC7A7
• Gene ID (NCBI): 9056
• RRID: AB_3669533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UM01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.