SLC9A3/NHE3 Polyclonal antibody

• 

  WB analysis using 33559-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33559-1-AP (SLC9A3/NHE3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 33559-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 33559-1-AP (SLC9A3/NHE3 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse kidney using 33559-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using SLC9A3/NHE3 antibody (33559-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse small intestine using 33559-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using SLC9A3/NHE3 antibody (33559-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC9A3/NHE3 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 33559-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

NHE3, NHE-3, SLC9A3

---

Tested Applications

• Positive WB detected in: 37°C incubated mouse kidney tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse small intestine tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33559-1-AP targets SLC9A3/NHE3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38302

  Product name: Recombinant human SLC9A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 750-834 aa of BC101669

  Sequence: AGIDNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFRRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM

• Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 3
• Calculated Molecular Weight: 834 aa, 93 kDa
• Observed Molecular Weight: 80-100 kDa
• GenBank Accession Number: BC101669
• Gene Symbol: NHE3
• Gene ID (NCBI): 6550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P48764
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC9A3, also known as NHE3, belongs to the sodium hydrogen exchange protein family (NHE) and is mainly responsible for regulating the concentration of sodium and hydrogen ions inside and outside the cell. SLC9A3 is a Major apical Na+/H+ exchanger in kidney and intestine, playing an important role in renal and intestine Na+ absorption and blood pressure regulation (PMID:24622516, 2635877). Mutations in SLC9A3 cause Congenital Sodium Diarrhea (PMID: 26358773, 31276831).