SLPI Polyclonal antibody

• 

SLPI Polyclonal Antibody for ELISA

Cat No. 15377-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

ELISA

Synonyms

ALK1, ALP, Antileukoproteinase, BLPI, HUSI, HUSI 1, HUSI I, MPI, Mucus proteinase inhibitor, Protease inhibitor WAP4, Seminal proteinase inhibitor, SLPI, WAP4, WFDC4

---

Product Information

15377-1-AP targets SLPI in ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1673

  Product name: Recombinant human SLPI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC020708

  Sequence: MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

• Full Name: secretory leukocyte peptidase inhibitor
• Calculated Molecular Weight: 14 kDa
• GenBank Accession Number: BC020708
• Gene Symbol: SLPI
• Gene ID (NCBI): 6590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P03973
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.