Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, HEK-293, HepG2 cells, MCF-7 cells, PC-3 cells, C6 cells, HEK-293 cells, HT-1080 cells, HUVEC cells, C2C12 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human colon cancer tissue, human stomach cancer tissue, human endometrial cancer tissue, mouse colon tissue, rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 194 publications below |
| IHC | See 11 publications below |
| IF | See 10 publications below |
| IP | See 3 publications below |
| CoIP | See 3 publications below |
| ChIP | See 2 publications below |
Product Information
12570-1-AP targets SMAD2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3237 Product name: Recombinant human SMAD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC014840 Sequence: MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAI Predict reactive species |
| Full Name | SMAD family member 2 |
| Calculated Molecular Weight | 467 aa, 52 kDa |
| Observed Molecular Weight | 52-70 kDa |
| GenBank Accession Number | BC014840 |
| Gene Symbol | SMAD2 |
| Gene ID (NCBI) | 4087 |
| RRID | AB_2193037 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15796 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMAD2, also named as MADH2 and MADR2, belongs to the dwarfin/SMAD family, contains 1 MH1 (MAD homology 1) domain and 1 MH2 (MAD homology 2) domain. SMAD2 is a receptor-regulated SMAD(R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. This protein may act as a tumor suppressor in colorectal carcinoma. It is phosphorylated on one or several of Thr-220, Ser-245, Ser-250, and Ser-255. In response to TGF-beta, It is phosphorylated on Ser-465/467 by TGF-beta and activin type 1 receptor kinases, and then able to interact with SMURF2, recruiting other proteins, such as SNON, for degradation. In response to decorin, the naturally occurring inhibitor of TGF-beta signaling, it is phosphorylated on Ser-240 by CaMK2. It is phosphorylated by MAPK3 upon EGF stimulation; which increases transcriptional activity and stability, and is blocked by calmodulin. In response to TGF-beta, it is ubiquitinated by NEDD4L, which promotes its degradation. In response to TGF-beta signaling, it is acetylated on Lys-19 by coactivators, which increases transcriptional activity. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SMAD2. The molecular weight of unphosphorylated forms of Smad2 is 52 kDa and phosphorylated forms of Smad2 is 58 kDa. (PMID: 9006934). The ubiquitination form of Smad2 is ~70 kDa (PMID: 25998442).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SMAD2 antibody 12570-1-AP | Download protocol |
| IHC protocol for SMAD2 antibody 12570-1-AP | Download protocol |
| IP protocol for SMAD2 antibody 12570-1-AP | Download protocol |
| WB protocol for SMAD2 antibody 12570-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Biomaterials A nano-conductive osteogenic hydrogel to locally promote calcium influx for electro-inspired bone defect regeneration | ||
Basic Res Cardiol The miR-182/Myadm axis regulates hypoxia-induced pulmonary hypertension by balancing the BMP- and TGF-β-signalling pathways in an SMC/EC-crosstalk-associated manner | ||
J Exp Clin Cancer Res ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK | ||
J Exp Clin Cancer Res N6-methyladenosine-modified circSLCO1B3 promotes intrahepatic cholangiocarcinoma progression via regulating HOXC8 and PD-L1 | ||
Drug Des Devel Ther Keloid Patient Plasma-Derived Exosomal hsa_circ_0020792 Promotes Normal Skin Fibroblasts Proliferation, Migration, and Fibrogenesis via Modulating miR-193a-5p and Activating TGF-β1/Smad2/3 Signaling | ||



























