Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SMAD2/3 Polyclonal antibody

SMAD2/3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

SMAD2, hMAD 2, hMAD-2, hSMAD2, JV18

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SMAD2/3 in ?

Tested Applications

Positive WB detected inA549 cells, HeLa cells, mouse skeletal muscle tissue, rat skeletal muscle tissue, HEK-293, HepG2 cells, MCF-7 cells, PC-3 cells, C6 cells, HEK-293 cells, HT-1080 cells, HUVEC cells, C2C12 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman colon cancer tissue, human stomach cancer tissue, human endometrial cancer tissue, mouse colon tissue, rat colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12570-1-AP targets SMAD2/3 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3237

Product name: Recombinant human SMAD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-355 aa of BC014840

Sequence: MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAI

Predict reactive species
Full Name SMAD family member 2
Calculated Molecular Weight 467 aa, 52 kDa
Observed Molecular Weight 52-70 kDa
GenBank Accession NumberBC014840
Gene Symbol SMAD2
Gene ID (NCBI) 4087
RRIDAB_2193037
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15796
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD2, also named as MADH2 and MADR2, belongs to the dwarfin/SMAD family, contains 1 MH1 (MAD homology 1) domain and 1 MH2 (MAD homology 2) domain. SMAD2 is a receptor-regulated SMAD(R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. This protein may act as a tumor suppressor in colorectal carcinoma. It is phosphorylated on one or several of Thr-220, Ser-245, Ser-250, and Ser-255. In response to TGF-beta, It is phosphorylated on Ser-465/467 by TGF-beta and activin type 1 receptor kinases, and then able to interact with SMURF2, recruiting other proteins, such as SNON, for degradation. In response to decorin, the naturally occurring inhibitor of TGF-beta signaling, it is phosphorylated on Ser-240 by CaMK2. It is phosphorylated by MAPK3 upon EGF stimulation; which increases transcriptional activity and stability, and is blocked by calmodulin. In response to TGF-beta, it is ubiquitinated by NEDD4L, which promotes its degradation. In response to TGF-beta signaling, it is acetylated on Lys-19 by coactivators, which increases transcriptional activity. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SMAD2. The molecular weight of unphosphorylated forms of Smad2 is 52 kDa and phosphorylated forms of Smad2 is 58 kDa. (PMID: 9006934). The ubiquitination form of Smad2 is ~70 kDa (PMID: 25998442).

Protocols

Product Specific Protocols
IF protocol for SMAD2/3 antibody 12570-1-APDownload protocol
IHC protocol for SMAD2/3 antibody 12570-1-APDownload protocol
IP protocol for SMAD2/3 antibody 12570-1-APDownload protocol
WB protocol for SMAD2/3 antibody 12570-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-SMAD2 antibody (Cat# 12570-1-AP) has accumulated 254 citations across journals including Nature Communications, Molecular Cancer, Theranostics, Cell Death & Disease, J Exp Clin Cancer Res, Science Advances, Oncogene, and over 100 additional journals. Key research fields encompass fibrosis (hepatic, pulmonary, cardiac, renal), TGF-β/Smad signaling, epithelial-mesenchymal transition, multiple cancer types (HCC, gastric, colorectal, lung, pancreatic), diabetic nephropathy, neuroinflammation, cardiovascular remodeling, and natural product pharmacology.

SpeciesApplicationTitle
humanWB

Mol Cancer

HDAC6 orchestrates metastatic and immunosuppressive programs in small cell lung cancer through S100A2-TGF-β/SMAD and CSF1R signaling.

Authors - Yantao Jiang
IF

Cancer Res

A feedback loop between hypoxia and matrix stress relaxation increases oxygen-axis migration and metastasis in sarcoma.

Authors - Daniel M Lewis
mouseWB

Nat Commun

The CCL20-integrin α5β1 interaction enhances TGF-β/Smad signaling to promote fibroblast activation in pulmonary fibrosis.

Authors - Suosi Liu
humanChIP

Nat Commun

Phosphorylation of FOXN3 by NEK6 promotes pulmonary fibrosis through Smad signaling

Authors - Jinjin Yu
humanWB

Exp Hematol Oncol

SEPHS1 promotes SMAD2/3/4 expression and hepatocellular carcinoma cells invasion.

Authors - Shu Yang

Theranostics

Single-cell RNA sequencing reveals that myeloid S100A8/A9 is a novel regulator of the transition from adaptive hypertrophy to heart failure after pressure overload

Authors - Wei-Jia Yu
Loading...
||
New chat

Able™

正在加载,请稍候...