Tested Applications
| Positive IHC detected in | human prostate cancer tissue, human testis tissue, human colon cancer tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20787-1-AP targets SMO in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14322 Product name: Recombinant human SMO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 546-787 aa of BC009989 Sequence: RRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF Predict reactive species |
| Full Name | smoothened homolog (Drosophila) |
| Calculated Molecular Weight | 787 aa, 86 kDa |
| GenBank Accession Number | BC009989 |
| Gene Symbol | SMO |
| Gene ID (NCBI) | 6608 |
| RRID | AB_2878740 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99835 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Smoothened (SMO) is a G protein-coupled receptor that is a component of the hedgehog (Hh) signaling pathway and is conserved from flies to humans. The Hh pathway plays a central role in animal development and stem-cell function. Defects in Hh signaling lead to birth defects and cancer in humans. Expressed on the primary cilium, SMO interacts with the patched protein, a receptor for Hh proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SMO antibody 20787-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SMO Polyclonal antibody (Cat# 20787-1-AP) has 54 citations. They appear in journals including Cell, Nature Communications, Science Advances, Molecular Cancer, Cell Reports, Cell Death & Disease, Journal of Cell Biology, FASEB Journal, and Oncology Reports. Research fields span Hedgehog/SMO signaling, cancer stem cells and epithelial-mesenchymal transition across multiple tumor types (lung, gastric, bladder, breast, liver, colorectal), primary cilia biology, organoid development, osteoarthritis, and neurodevelopment. Applications include IF, IHC, and WB.
| Species | Application | Title |
|---|---|---|
Mol Cancer Circular RNA circIPO11 drives self-renewal of liver cancer initiating cells via Hedgehog signaling. | ||
Nat Commun TSPAN8 promotes cancer cell stemness via activation of sonic Hedgehog signaling. | ||
J Nanobiotechnology NaHS@Cy5@MS@SP nanoparticles improve rheumatoid arthritis by inactivating the Hedgehog signaling pathway through sustained and targeted release of H2S into the synovium | ||
Sci Adv Primary cilium remodeling mediates a cell signaling switch in differentiating neurons. | ||
Cell Death Dis METTL3-mediated m6A modification of STEAP2 mRNA inhibits papillary thyroid cancer progress by blocking the Hedgehog signaling pathway and epithelial-to-mesenchymal transition. |
Reviews
What customers say
The single review for this antibody (rated 4/5) reports use in Western Blot and Immunofluorescence on MEF cells. For IF, the antibody successfully labeled the ciliary localization of endogenous Smoothened. For WB, it detected multiple bands around 100 kDa. Overall, the reviewer found the antibody functional for both applications, with clear ciliary staining in IF, though WB showed several bands near the expected molecular weight rather than a single clean band.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (05-13-2019) | For IF, it could label the ciliary localisation of endogenous Smo; for WB, it could label many bands around 100 kd.
|
