Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, human kidney tissue, human liver tissue, K-562 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | mouse kidney tissue, human kidney tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12704-1-AP targets SNAP29 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3382 Product name: Recombinant human SNAP29 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC009715 Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL Predict reactive species |
| Full Name | synaptosomal-associated protein, 29kDa |
| Calculated Molecular Weight | 258 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC009715 |
| Gene Symbol | SNAP29 |
| Gene ID (NCBI) | 9342 |
| RRID | AB_2192340 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95721 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for the fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. SNAP29 also plays a role in ciliogenesis by regulating membrane fusions.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SNAP29 antibody 12704-1-AP | Download protocol |
| IP protocol for SNAP29 antibody 12704-1-AP | Download protocol |
| WB protocol for SNAP29 antibody 12704-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SNAP29 antibody (catalog number 12704-1-AP) has 46 citations. These appear in journals including Nature Cell Biology, Autophagy, Nature Communications, Hepatology, Science Advances, Cell Reports, Journal of Cell Biology, and iScience. Research fields span autophagy and autophagosome-lysosome fusion, viral replication, ferroptosis, neurodegeneration (Alzheimer's, Parkinson's, stroke), cancer, and lysosomal dynamics. Applications are predominantly Western blot, with some IF, IHC, IP, and CoIP.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
| ||
Nat Cell Biol Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.
| ||
Autophagy Porcine reproductive and respiratory syndrome virus hijacks the non-canonical enzymatic function of PHGDH to arrest autophagic flux for viral replication. | ||
Autophagy Pseudorabies virus gM protein and herpesvirus homologs block selective autophagy to enhance viral replication
| ||
Autophagy METTL3-dependent m6A modification of SNAP29 induces "autophagy-mitochondrial crisis" in the ischemic microenvironment after soft tissue transplantation | ||
Autophagy The ORF7a protein of SARS-CoV-2 initiates autophagy and limits autophagosome-lysosome fusion via degradation of SNAP29 to promote virus replication. |
Reviews
What customers say
The reviewer tested this antibody for Western Blot (1:2000) and Immunofluorescence (1:500) in stable HeLa cells expressing sec61b-GFP. In WB, a likely specific band appeared at ~30 kDa with strong reduction upon SNAP29 siRNA knockdown, but notable nonspecific signals were observed at ~40 kDa and ~70 kDa. For IF, mitotic cells showed broad cytoplasmic staining excluding the chromosomal region, while interphase cells displayed a more diffuse signal with stronger, possibly specific staining at vesicle edges. Overall, the antibody demonstrated partial specificity with significant background, earning a 2/5 rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Simone (Verified Customer) (03-02-2023) | I used the antibody one time for a westernblot analysis of cells (Stable HeLa cell line expressing sec61b-GFP) which I transfected with siRNA targeting SNAP29 on the one hand and scrambled siRNA on the other hand. I observed a probably specific signal at around 30 kDa, indicated by a strong reduction in the sample from the cells in which I down regulated the protein. I observed a strong unspecific signal at around 40 kDa and weaker unspecific signals at around 70 kDa. I also used the antibody for immunofluorescence one time. I transfected the cells as for the western blot and fixed them with PLP on coverslips and incubated the coverslips overnight with the antibody at 4°C. On the next day I stained the coverslips using an anti rabbit antibody, coupled with Alexa 568 fluorophore. I imaged mainly mitotic cells (see picture attached). I observed a broad staining of the hole cells, leaving out the chromosomal area. I also imaged a few interphase cells, but also observed a rather broad signal. In some interphase cells, especially at the edge of some kind of vesicles I observed a stronger, probably specific staining.
 |
