• Featured Product
  • KD/KO Validated

SNAP29 Polyclonal antibody

SNAP29 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 12704-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

SNAP-29, CEDNIK, SNAP 29, Synaptosomal-associated protein 29, Vesicle-membrane fusion protein SNAP-29

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, human kidney tissue, human liver tissue, K-562 cells
Positive IP detected inJurkat cells
Positive IHC detected inmouse kidney tissue, human kidney tissue, human stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-12 cells, HEK-293 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12704-1-AP targets SNAP29 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3382

Product name: Recombinant human SNAP29 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-258 aa of BC009715

Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

Predict reactive species
Full Name synaptosomal-associated protein, 29kDa
Calculated Molecular Weight 258 aa, 29 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC009715
Gene Symbol SNAP29
Gene ID (NCBI) 9342
RRIDAB_2192340
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95721
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for the fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. SNAP29 also plays a role in ciliogenesis by regulating membrane fusions.

Protocols

Product Specific Protocols
IF protocol for SNAP29 antibody 12704-1-APDownload protocol
IHC protocol for SNAP29 antibody 12704-1-APDownload protocol
IP protocol for SNAP29 antibody 12704-1-APDownload protocol
WB protocol for SNAP29 antibody 12704-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.

Authors - Quanlong Lu
  • KD Validated
mouseWB

Nat Cell Biol

Early steps in primary cilium assembly require EHD1/EHD3-dependent ciliary vesicle formation.

Authors - Quanlong Lu
  • KD Validated
humanWB

Autophagy

SDC1-dependent TGM2 determines radiosensitivity in glioblastoma by coordinating EPG5-mediated fusion of autophagosomes with lysosomes

Authors - Wang Zheng
humanWB

Nat Commun

Kansl1 haploinsufficiency impairs autophagosome-lysosome fusion and links autophagic dysfunction with Koolen-de Vries syndrome in mice.

Authors - Ting Li
humanWB,IF

Nat Commun

KRAS regulation by small non-coding RNAs and SNARE proteins.

Authors - Yonglu Che
human

Autophagy

The ORF7a protein of SARS-CoV-2 initiates autophagy and limits autophagosome-lysosome fusion via degradation of SNAP29 to promote virus replication.

Authors - Peili Hou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Simone (Verified Customer) (03-02-2023)

I used the antibody one time for a westernblot analysis of cells (Stable HeLa cell line expressing sec61b-GFP) which I transfected with siRNA targeting SNAP29 on the one hand and scrambled siRNA on the other hand. I observed a probably specific signal at around 30 kDa, indicated by a strong reduction in the sample from the cells in which I down regulated the protein. I observed a strong unspecific signal at around 40 kDa and weaker unspecific signals at around 70 kDa. I also used the antibody for immunofluorescence one time. I transfected the cells as for the western blot and fixed them with PLP on coverslips and incubated the coverslips overnight with the antibody at 4°C. On the next day I stained the coverslips using an anti rabbit antibody, coupled with Alexa 568 fluorophore. I imaged mainly mitotic cells (see picture attached). I observed a broad staining of the hole cells, leaving out the chromosomal area. I also imaged a few interphase cells, but also observed a rather broad signal. In some interphase cells, especially at the edge of some kind of vesicles I observed a stronger, probably specific staining.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:2000 for Westernblot and 1:500 for Immunofluorescence
  • Cell Tissue Type: Stable HeLa cell line expressing sec61b-GFP
SNAP29 Antibody Western Blot,Immunofluorescence validation (1:2000 for Westernblot and 1:500 for Immunofluorescence dilution) in Stable HeLa cell line expressing sec61b-GFP (Cat no:12704-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...