SNIP/p140Cap Polyclonal antibody

• 

  WB analysis using 29890-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29890-1-AP (SNIP antibody) at dilution of 1:30000 incubated at room temperature for 1.5 hours.

SNIP/p140Cap Polyclonal Antibody for WB, ELISA

Cat No. 29890-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA1684, p130Cas associated protein, P140, p140Cap, SNAP 25 interacting protein, SNAP25 interacting protein, SNIP, SRCIN1

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29890-1-AP targets SNIP/p140Cap in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31857

  Product name: Recombinant human SNIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1011-1182 aa of

  Sequence: RSFPSSHGLTTTRTGEVVVTSKKDSAFIKKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDEDDEDRIIAELESGGGSVPPMKVVTPGASRLKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSIS

• Full Name: SNAP25-interacting protein
• Calculated Molecular Weight: 127 kDa
• Observed Molecular Weight: 145 kDa
• Gene Symbol: SNIP
• Gene ID (NCBI): 80725
• RRID: AB_3086180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C0H9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNIP, also named SRC kinase signaling inhibitor 1 (SRCIN1) and p140 Cas-associated protein (p140CAP), contains two regions of highly charged amino acids, two proline-rich regions, and two coiled-coil domains. SNIP plays a role in SRC inactivation and acts as a tumor suppressor gene in cancers. MiR-32 suppresses the expression of SNIP, thereby suppressing proliferation and epithelial-mesenchymal transition (EMT) of human liver cancer cells (PMID: 28550679).