SNRPF Polyclonal antibody

• 

  WB analysis of human heart using 14977-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14977-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14977-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 14977-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 14977-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 14977-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 14977-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14977-1-AP (SNRPF antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14977-1-AP (SNRPF antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human breast cancer using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14977-1-AP (SNRPF antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human breast cancer using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14977-1-AP (SNRPF antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human breast cancer using 14977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 14977-1-AP (SNRPF antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 14977-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 14977-1-AP (SNRPF antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

SNRPF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14977-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PBSCF, Sm F, Sm protein F, SMF, Sm-F

---

Tested Applications

• Positive WB detected in: human heart tissue, HeLa cells, HepG2 cells, MCF-7 cells, mouse kidney tissue, mouse liver tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14977-1-AP targets SNRPF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6889

  Product name: Recombinant human SNRPF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-86 aa of BC002505

  Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE

• Full Name: small nuclear ribonucleoprotein polypeptide F
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC002505
• Gene Symbol: SNRPF
• Gene ID (NCBI): 6636
• RRID: AB_2302166
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62306
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The 4 major small nuclear ribonucleoprotein particles (snRNPs), U1, U2, U4/U6, and U5, are essential components of the eukaryotic pre-mRNA splicing machinery. These snRNPs share 8 proteins which form the snRNP structural core: B/B-prime (SNRPB), D1 (SNRPD1), D2 (SNRPD2), D3 (SNRPD3), E (SNRPE), F (SNRPF), and G (SNRPG). These proteins have a role in the biogenesis of the snRNPs.