SNX24 Polyclonal antibody, PBS Only

• 

  WB analysis using 16799-1-AP (same clone as 16799-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16799-1-AP (SNX24 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16799-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 16799-1-AP (same clone as 16799-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16799-1-AP (SNX24 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16799-1-PBS in a different storage buffer formulation.

SNX24 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16799-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Sorting Nexin 24, SBBI31, PRO1284

---

Product Information

16799-1-PBS targets SNX24 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10278

  Product name: Recombinant human SNX24 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-159 aa of BC069012

  Sequence: MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASGNQTCHLLTALY

• Full Name: sorting nexin 24
• Calculated Molecular Weight: 159 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC069012
• Gene Symbol: SNX24
• Gene ID (NCBI): 28966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y343
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.