SNX25 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNX25 Polyclonal antibody (13294-1-AP)

• Featured Product
• KD/KO Validated

SNX25 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 13294-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Sorting nexin-25, sorting nexin 25, SBBI31, MSTP043

• 

  WB analysis using 13294-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13294-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 13294-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 13294-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Raji using 13294-1-AP

  IP result of anti-SNX25 (IP:13294-1-AP, 4ug; Detection:13294-1-AP 1:2000) with Raji cells lysate 1600 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13294-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SNX25 antibody (13294-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SNX25 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: EL-4 cells, Raji cells, Jurkat cells, mouse thymus tissue, C6 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: Raji cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13294-1-AP targets SNX25 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3995

  Product name: Recombinant human SNX25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-556 aa of BC029868

  Sequence: QINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV

• Full Name: sorting nexin 25
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 98-105 kDa, 65 kDa
• GenBank Accession Number: BC029868
• Gene Symbol: SNX25
• Gene ID (NCBI): 83891
• RRID: AB_2192549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3E2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNXs (sorting nexin), a family of proteins playing roles in cargo sorting and signaling from compartments within the endocytic network, regulate traffic of membrane proteins including TGF-β receptors. Sorting Nexin 25 (SNX25) has been recently proposed to modulate TGF-β signaling through endosomal sorting of TGF-β receptors for lysosomal degradation.This antibody can recognize two isoforms: 98-105 kDa and 65 kDa.

Publications

What published studies show

The SNX25 Polyclonal antibody (catalog number 13294-1-AP) has 7 total citations. These appear in journals including Nature Immunology, Redox Biology, Scientific Reports, Brain Structure and Function, PLoS One, Neuroscience Letters, and Acta Histochemica et Cytochemica. The associated research fields span immunology (macrophage function, pain sensitivity, NGF signaling), redox biology and GPCR signaling, neurobiology (tyrosine receptor kinase trafficking, circadian rhythms), inflammation (NF-κB signaling), and cardiovascular disease (atherosclerosis).

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Immunol; Dermal macrophages set pain sensitivity by modulating the amount of tissue NGF through an SNX25-Nrf2 pathway; Authors - Tatsuhide Tanaka
human	WB,CoIP	Redox Biol; Redox-modulated SNX25 as a novel regulator of GPCR-G protein signaling from endosomes; Authors - Yulong Zhang
mouse	WB	Sci Rep; Dermal macrophages control tactile perception under physiological conditions via NGF signaling; Authors - Tatsuhide Tanaka
mouse	IHC	Brain Struct Funct; Neural expression of sorting nexin 25 and its regulation of tyrosine receptor kinase B trafficking.; Authors - Shoko Takemura
mouse	WB	PLoS One; SNX25 regulates proinflammatory cytokine expression via the NF-κB signal in macrophages.; Authors - Kazuya Nishimura ; KD Validated
mouse	WB	Neurosci Lett; Circadian rhythms of sorting nexin 25 in the mouse suprachiasmatic nucleus.; Authors - Shoko Takemura