SNX25 Polyclonal antibody

• 

  WB analysis using 13294-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13294-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 13294-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 13294-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13294-1-AP (SNX25 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Raji using 13294-1-AP

  IP result of anti-SNX25 (IP:13294-1-AP, 4ug; Detection:13294-1-AP 1:2000) with Raji cells lysate 1600 ug.

• 

  IF Staining of HeLa using 13294-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using SNX25 antibody (13294-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

SNX25 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 13294-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Sorting nexin-25, sorting nexin 25, SBBI31, MSTP043

---

Tested Applications

• Positive WB detected in: EL-4 cells, Raji cells, Jurkat cells, mouse thymus tissue, C6 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: Raji cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

13294-1-AP targets SNX25 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3995

  Product name: Recombinant human SNX25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 207-556 aa of BC029868

  Sequence: QINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV

• Full Name: sorting nexin 25
• Calculated Molecular Weight: 98 kDa
• Observed Molecular Weight: 98-105 kDa, 65 kDa
• GenBank Accession Number: BC029868
• Gene Symbol: SNX25
• Gene ID (NCBI): 83891
• RRID: AB_2192549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3E2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNXs (sorting nexin), a family of proteins playing roles in cargo sorting and signaling from compartments within the endocytic network, regulate traffic of membrane proteins including TGF-β receptors. Sorting Nexin 25 (SNX25) has been recently proposed to modulate TGF-β signaling through endosomal sorting of TGF-β receptors for lysosomal degradation.This antibody can recognize two isoforms: 98-105 kDa and 65 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Brain Struct Funct; Neural expression of sorting nexin 25 and its regulation of tyrosine receptor kinase B trafficking.; Authors - Shoko Takemura
mouse	WB	PLoS One; SNX25 regulates proinflammatory cytokine expression via the NF-κB signal in macrophages.; Authors - Kazuya Nishimura ; KD Validated
mouse	WB	Neurosci Lett; Circadian rhythms of sorting nexin 25 in the mouse suprachiasmatic nucleus.; Authors - Shoko Takemura
mouse	WB,IF	Nat Immunol; Dermal macrophages set pain sensitivity by modulating the amount of tissue NGF through an SNX25-Nrf2 pathway; Authors - Tatsuhide Tanaka
human	WB,CoIP	Redox Biol; Redox-modulated SNX25 as a novel regulator of GPCR-G protein signaling from endosomes; Authors - Yulong Zhang
mouse	WB	Sci Rep; Dermal macrophages control tactile perception under physiological conditions via NGF signaling; Authors - Tatsuhide Tanaka