SNX29 Polyclonal antibody

• 

  WB analysis of HepG2 using 30512-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 30512-1-AP (SNX29 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 30512-1-AP

  WB result of SNX29 antibody (30512-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SNX29 transfected HepG2 cells.

• Featured Product
• KD/KO Validated

SNX29 Polyclonal Antibody for WB, ELISA

Cat No. 30512-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

---

Tested Applications

• Positive WB detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30512-1-AP targets SNX29 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32567

  Product name: Recombinant human SNX29 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-150 aa of XM_011522738

  Sequence: MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRCRLSTFYEDWS

• Full Name: sorting nexin 29
• Calculated Molecular Weight: 91kd
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: XM_011522738
• Gene Symbol: SNX29
• Gene ID (NCBI): 92017
• RRID: AB_3669729
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TEQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX29 (Sorting nexin 29) is associated with bipolar disorder (BPD) and major depressive disorder (MDD) in the Han population (PMID: 33143498). The expression of SNX29 is significantly upregulated in most tumor tissues, and its expression is associated with the progression, immune infiltration and drug sensitivity of various cancers (PMID: 36829159).