SOCS2 Polyclonal antibody

• 

  WB analysis using 26206-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26206-1-AP (SOCS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

SOCS2 Polyclonal Antibody for WB, ELISA

Cat No. 26206-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

Synonyms

SSI2, SOCS-2, SOCS 2, Cytokine-inducible SH2 protein 2, CIS-2

---

Tested Applications

• Positive WB detected in: K-562 cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

26206-1-AP targets SOCS2 in WB, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24394

  Product name: Recombinant human SOCS2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 89-198 aa of BC010399

  Sequence: SAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

• Full Name: suppressor of cytokine signaling 2
• Calculated Molecular Weight: 198 aa, 22 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC010399
• Gene Symbol: SOCS2
• Gene ID (NCBI): 8835
• RRID: AB_3669527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14508
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOCS2 is the substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as EPOR and GHR (PMID: 11781573; 21980433; 25505247; 31182716; 34857742).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Rep (Hoboken); Expression Characteristics, Immune Signature, and Prognostic Value of the SOCS Family Identified by Multiomics Integrative Analysis in Liver Cancer; Authors - Zhitao Dong