SOCS3 Monoclonal antibody

• 

  WB analysis using 66797-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66797-1-Ig (SOCS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of Jurkat using 66797-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66797-1-Ig (SOCS3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 66797-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66797-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 66797-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 66797-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 66797-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using SOCS3 antibody (66797-1-Ig, Clone: 1G2B12 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

SOCS3 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66797-1-Ig

Clone No.1G2B12

Publications(18)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

1G2B12, ATOD4, CIS3, CIS-3, Cytokine-inducible SH2 protein 3

---

Tested Applications

• Positive WB detected in: Daudi cells, Jurkat cells, Ramos cells, CTLL-2 cells, pig spleen tissue
• Positive IHC detected in: human breast cancer tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 16 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

66797-1-Ig targets SOCS3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5386

  Product name: Recombinant human SOCS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-225 aa of BC060858

  Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

• Full Name: suppressor of cytokine signaling 3
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC060858
• Gene Symbol: SOCS3
• Gene ID (NCBI): 9021
• RRID: AB_2882141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14543
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Suppressor of cytokine signaling 3 (SOCS3) is a member of SOCS family that these proteins induced to attenuate cytokine signal transduction in response to signals from a diverse range of cytokines and growth factors. SOCS3 is a negative regulatory protein that inhibits signaling induced by IL-6 via preventing JAK mediated activation of STAT3. However SOCS3 can positively regulate the ERK-MAPK pathway, inhibit the NF-kB pathway (PMID:26429311,25035930). In addition, SOCS3 brings a great impact on immune responses by inhibiting signaling stimulus, such as LPS, type I and type II IFNs, and IL-12. SOCS3 is widely expressed in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney (PMID: 22961088). Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer (PMID:26429311).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC	Acta Pharmacol Sin; Epac activation ameliorates tubulointerstitial inflammation in diabetic nephropathy.; Authors - Wen-Xia Yang ; KD Validated
mouse	WB	Int J Mol Sci; Alterations in Leptin Signaling in Amyotrophic Lateral Sclerosis (ALS).; Authors - Agueda Ferrer-Donato
rat	WB,IP	Int J Mol Sci; Leptin Modulates the Response of Brown Adipose Tissue to Negative Energy Balance: Implication of the GH/IGF-I Axis.; Authors - Vicente Barrios
mouse	IF	iScience; IL-17A produced by POMC neurons regulates diet-induced obesity; Authors - Rosa Gallo
mouse	WB	J Ethnopharmacol; Simiao San alleviates hyperuricemia and kidney inflammation by inhibiting NLRP3 inflammasome and JAK2/STAT3 signaling in hyperuricemia mice; Authors - Yueyi Zhang
mouse	WB	Mol Nutr Food Res; Single Treatment of Vitamin D3 Ameliorates LPS-Induced Acute Lung Injury through Changing Lung Rodentibacter abundance.; Authors - Ai Jin