Filter: AllWBIHCIF-P

WB analysis using 66797-1-Ig (same clone as 66797-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66797-1-Ig (SOCS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 66797-1-Ig (SOCS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 66797-1-Ig (same clone as 66797-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 66797-1-Ig (SOCS3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66797-1-Ig (same clone as 66797-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66797-1-Ig (same clone as 66797-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 66797-1-Ig (same clone as 66797-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 66797-1-Ig (same clone as 66797-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 66797-1-Ig (SOCS3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.
IF Staining of mouse heart using 66797-1-Ig (same clone as 66797-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using SOCS3 antibody (66797-1-Ig, Clone: 1G2B12 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66797-1-PBS in a different storage buffer formulation.

SOCS3 Monoclonal antibody, PBS Only

SOCS3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66797-1-PBS

Clone No.1G2B12

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

1G2B12, ATOD4, CIS3, CIS-3, Cytokine-inducible SH2 protein 3

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66797-1-PBS targets SOCS3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag5386 Product name: Recombinant human SOCS3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-225 aa of BC060858 Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL Predict reactive species
Full Name	suppressor of cytokine signaling 3
Calculated Molecular Weight	25 kDa
Observed Molecular Weight	25 kDa
GenBank Accession Number	BC060858
Gene Symbol	SOCS3
Gene ID (NCBI)	9021
RRID	AB_2882141
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	O14543
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Suppressor of cytokine signaling 3 (SOCS3) is a member of SOCS family that these proteins induced to attenuate cytokine signal transduction in response to signals from a diverse range of cytokines and growth factors. SOCS3 is a negative regulatory protein that inhibits signaling induced by IL-6 via preventing JAK mediated activation of STAT3. However SOCS3 can positively regulate the ERK-MAPK pathway, inhibit the NF-kB pathway (PMID:26429311,25035930). In addition, SOCS3 brings a great impact on immune responses by inhibiting signaling stimulus, such as LPS, type I and type II IFNs, and IL-12. SOCS3 is widely expressed in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney (PMID: 22961088). Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer (PMID:26429311).