SOCS3 Monoclonal antibody, PBS Only

SOCS3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 66797-1-PBS
Clone No.1G2B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

1G2B12, ATOD4, CIS3, CIS-3, Cytokine-inducible SH2 protein 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66797-1-PBS targets SOCS3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5386

Product name: Recombinant human SOCS3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-225 aa of BC060858

Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Predict reactive species
Full Name suppressor of cytokine signaling 3
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC060858
Gene Symbol SOCS3
Gene ID (NCBI) 9021
RRIDAB_2882141
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO14543
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Suppressor of cytokine signaling 3 (SOCS3) is a member of SOCS family that these proteins induced to attenuate cytokine signal transduction in response to signals from a diverse range of cytokines and growth factors. SOCS3 is a negative regulatory protein that inhibits signaling induced by IL-6 via preventing JAK mediated activation of STAT3. However SOCS3 can positively regulate the ERK-MAPK pathway, inhibit the NF-kB pathway (PMID:26429311,25035930). In addition, SOCS3 brings a great impact on immune responses by inhibiting signaling stimulus, such as LPS, type I and type II IFNs, and IL-12. SOCS3 is widely expressed in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney (PMID: 22961088). Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer (PMID:26429311).

Loading...
||
New chat Able
正在加载,请稍候...