• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated SOCS3 Monoclonal antibody

SOCS3 Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL594-66797
Clone No.1G2B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

1G2B12, ATOD4, CIS3, CIS-3, Cytokine-inducible SH2 protein 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66797 targets SOCS3 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5386

Product name: Recombinant human SOCS3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-225 aa of BC060858

Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Predict reactive species
Full Name suppressor of cytokine signaling 3
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC060858
Gene Symbol SOCS3
Gene ID (NCBI) 9021
RRIDAB_3084727
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO14543
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Suppressor of cytokine signaling 3 (SOCS3) is a member of SOCS family that these proteins induced to attenuate cytokine signal transduction in response to signals from a diverse range of cytokines and growth factors. SOCS3 is a negative regulatory protein that inhibits signaling induced by IL-6 via preventing JAK mediated activation of STAT3. However SOCS3 can positively regulate the ERK-MAPK pathway, inhibit the NF-kB pathway (PMID:26429311,25035930). In addition, SOCS3 brings a great impact on immune responses by inhibiting signaling stimulus, such as LPS, type I and type II IFNs, and IL-12. SOCS3 is widely expressed in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney (PMID: 22961088). Dysregulation of SOCS3 functions can cause a variety of diseases, including allergy, autoimmune diseases, inflammation and cancer (PMID:26429311).

Protocols

Product Specific Protocols
FC protocol for CL594 SOCS3 antibody CL594-66797Download protocol
IF protocol for CL594 SOCS3 antibody CL594-66797Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...