Product Information
84936-2-PBS targets SOX17 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19157 Product name: Recombinant human SOX17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC111365 Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 17 |
| Calculated Molecular Weight | 414 aa, 44 kDa |
| GenBank Accession Number | BC111365 |
| Gene Symbol | SOX17 |
| Gene ID (NCBI) | 64321 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H6I2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
