Product Information
83660-2-PBS targets SOX4 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26583 Product name: Recombinant human SOX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 70-160 aa of BC072668 Sequence: SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGG Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 4 |
| Calculated Molecular Weight | 474 aa, 47 kDa |
| GenBank Accession Number | BC072668 |
| Gene Symbol | SOX4 |
| Gene ID (NCBI) | 6659 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q06945 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
