Product Information
83660-3-PBS targets SOX4 as part of a matched antibody pair:
MP00619-1: 83660-1-PBS capture and 83660-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26583 Product name: Recombinant human SOX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 70-160 aa of BC072668 Sequence: SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGG Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 4 |
| Calculated Molecular Weight | 474 aa, 47 kDa |
| GenBank Accession Number | BC072668 |
| Gene Symbol | SOX4 |
| Gene ID (NCBI) | 6659 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q06945 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





