SP-D/SFTPD Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP02661-1

  Plasma of seven individual healthy human donors was measured. The Surfactant protein D concentration of detected samples was determined to be 2.24 ng/mL with a range of 0.25-4.59 ng/mL.

• 

  Sandwich ELISA standard curve of MP02661-1

  Sandwich ELISA standard curve of MP02661-1, Human Surfactant protein D Recombinant Matched Antibody Pair - PBS only. 86416-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg4996. 86416-3-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

SP-D/SFTPD Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 86416-4-PBS

Clone No.250947A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

SFTPD, COLEC7, Collectin 7, Collectin-7, Lung surfactant protein D

---

Product Information

86416-4-PBS targets SP-D/SFTPD as part of a matched antibody pair:

MP02661-1: 86416-4-PBS capture and 86416-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4996

  Product name: recombinant human SP-D/SFTPD protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-375 aa of NM_003019.5

  Sequence: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF

• Full Name: surfactant protein D
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: NM_003019.5
• Gene Symbol: Surfactant protein D
• Gene ID (NCBI): 6441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35247
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.