• Featured Product
  • KD/KO Validated

SP1 Polyclonal antibody

SP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21962-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

SP1, Sp1 transcription factor, Transcription factor Sp1, TSFP1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, A431 cells, HEK-293 cells, HeLa cells, K-562 cells
Positive IP detected inA431 cells
Positive IHC detected inhuman lung cancer tissue, human colon tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21962-1-AP targets SP1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Cited Reactivityhuman, mouse, rat, pig, monkey, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16720

Product name: Recombinant human SP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 437-785 aa of BC062539

Sequence: NLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF

Predict reactive species
Full Name Sp1 transcription factor
Calculated Molecular Weight 785 aa, 81 kDa
Observed Molecular Weight 95-106 kDa
GenBank Accession NumberBC062539
Gene Symbol SP1
Gene ID (NCBI) 6667
ENSEMBL Gene IDENSG00000185591
RRIDAB_10898171
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08047
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The transcription factor Sp1 is a C2H2 zinc-finger protein that is involved in the regulation of a wide variety of genes, including housekeeping genes and tumor-developing genes. It is associated with tumor development, growth, and metastasis [PMID: 16209919]. It regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Besides, it has a role in modulating the cellular response to DNA damage, recruiting SMARCA4/BRG1 on the c-FOS promoter, regulation of FE65 gene expression [PMID:11371615,16332679]. SP1 is detected with MW 95-105 kDa and 65 kDa in this paper(PMID: 10618488).

Protocols

Product Specific Protocols
WB protocol for SP1 antibody 21962-1-APDownload protocol
IHC protocol for SP1 antibody 21962-1-APDownload protocol
IF protocol for SP1 antibody 21962-1-APDownload protocol
IP protocol for SP1 antibody 21962-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Cell

KMT2C deficiency drives transdifferentiation of double-negative prostate cancer and confer resistance to AR-targeted therapy

Authors - Jiacheng Guo
humanWB

Protein Cell

Integrative analysis of transcriptome, DNA methylome and chromatin accessibility reveals candidate therapeutic targets in hypertrophic cardiomyopathy

Authors - Junpeng Gao
humanWB

Cell Res

Hepatocellular carcinoma redirects to ketolysis for progression under nutrition deprivation stress.

Authors - De Huang
humanWB

Cell Rep Med

Disruption of MerTK increases the efficacy of checkpoint inhibitor by enhancing ferroptosis and immune response in hepatocellular carcinoma

Authors - Shun Wang
mouseWB

Sci Adv

Targeting actin-bundling protein L-plastin as an anabolic therapy for bone loss.

Authors - Xiaoqun Li
humanWB

Nucleic Acids Res

High mobility group AT-hook 1 (HMGA1) is an important positive regulator of hepatitis B virus (HBV) that is reciprocally upregulated by HBV X protein.

Authors - Zhongliang Shen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Anh (Verified Customer) (07-15-2021)

have some unspecific bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: adult mouse cardiomyocytes
SP1 Antibody Western Blot validation (1:500 dilution) in adult mouse cardiomyocytes (Cat no:21962-1-AP)
FH

Hannah (Verified Customer) (06-08-2020)

Single band at predicted size with with 2 minute exposure

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: MRC5
FH

David (Verified Customer) (01-15-2020)

Gave a single clear band at the expected molecular weight. Low protein input was used (10µg) for experimental reasons, hence the low antibody dilution required (1:100).

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: SH-SY5Y
Loading...