SPG11 Polyclonal antibody

• 

  IHC staining of human liver using 16555-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16555-1-AP (SPG11 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 16555-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16555-1-AP (SPG11 Antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

SPG11 Polyclonal Antibody for IHC, ELISA

Cat No. 16555-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, CoIP, ELISA

Synonyms

KIAA1840, Spastic paraplegia 11 protein, SPATACSIN, SPG11

---

Tested Applications

• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 8 publications below
• CoIP: See 1 publications below

Product Information

16555-1-AP targets SPG11 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9769

  Product name: Recombinant human SPG11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-482 aa of BC024161

  Sequence: TLVGMKLLDKISSVPHGELSCTTELLILAHHCFTLTCHMEGIIRVLQAAHMLTDNHLAPSEEYGLVVRLLTGIGRYNEMTYIFDLLHKKHYFEVLMRKKLDPSGTLKTALLDYIKRCRPGDSEKHNMIALCFSMCREIGENHEAAARIQLKLIESQPWEDSLKDGHQLKQLLLKALTLMLDAAESYAKDSCVRQAQHCQRLTKLITLQIHFLNTGQNTMLINLGRHKLMDCILALPRFYQASIVAEAYDFVPDWAEILYQQVILKGDFNYLEEFKQQRLLKSSIFEEISKKYKQHQPTDMVMENLKKLLTYCEDVYLYYKLAYEHKFYEIVNVLLKDPQTGCCLKDMLAG

• Full Name: spastic paraplegia 11 (autosomal recessive)
• Calculated Molecular Weight: 2443 aa, 279 kDa
• GenBank Accession Number: BC024161
• Gene Symbol: SPG11
• Gene ID (NCBI): 80208
• RRID: AB_2878277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JI7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Science; NUFIP1 is a ribosome receptor for starvation-induced ribophagy.; Authors - Gregory A Wyant
human	WB	J Clin Invest; Spastic paraplegia proteins spastizin and spatacsin mediate autophagic lysosome reformation.; Authors - Jaerak Chang
mouse	WB	PLoS Genet; A hereditary spastic paraplegia mouse model supports a role of ZFYVE26/SPASTIZIN for the endolysosomal system.; Authors - Mukhran Khundadze
human	WB	Hum Mol Genet; SPG15 protein deficits are at the crossroads between lysosomal abnormalities, altered lipid metabolism and synaptic dysfunction.; Authors - Lara Marrone
mouse	WB	Neurobiol Dis; Loss of spatacsin function alters lysosomal lipid clearance leading to upper and lower motor neuron degeneration.; Authors - Julien Branchu ; KO Validated
human	WB	Ann Clin Transl Neurol; Lysosomal abnormalities in hereditary spastic paraplegia types SPG15 and SPG11.; Authors - Benoît Renvoisé ; KD Validated