SPIB Polyclonal antibody, PBS Only

• 

  WB analysis of L02 using 15768-1-AP (same clone as 15768-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 15768-1-AP (SPIB Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15768-1-PBS in a different storage buffer formulation.

• 

  IP experiment of L02 using 15768-1-AP (same clone as 15768-1-PBS)

  IP result of anti-SPIB (IP:15768-1-AP, 4ug; Detection:15768-1-AP 1:300) with L02 cells lysate 1800ug. This data was developed using the same antibody clone with 15768-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15768-1-AP (same clone as 15768-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15768-1-AP (SPIB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15768-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15768-1-AP (same clone as 15768-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15768-1-AP (SPIB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15768-1-PBS in a different storage buffer formulation.

SPIB Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15768-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

15768-1-PBS targets SPIB in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8404

  Product name: Recombinant human SPIB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-262 aa of BC007921

  Sequence: MLALEAAQLDGPHFSCLYPDGVFYDLDSCKHSSYPDSEGAPDSLWDWTVAPPVPATPYEAFDPAAAAFSHPQAAQLCYEPPTYSPAGNLELAPSLEAPGPGLPAYPTENFASQTLVPPAYAPYPSPVLSEEEDLPLDSPALEVSDSESDEALVAGPEGKGSEAGTRKKLRLYQFLLGLLTRGDMRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA

• Full Name: Spi-B transcription factor (Spi-1/PU.1 related)
• Calculated Molecular Weight: 262 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC007921
• Gene Symbol: SPIB
• Gene ID (NCBI): 6689
• RRID: AB_2878182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01892
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.