SPOP Monoclonal antibody

• 

  WB analysis using 68216-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68216-1-Ig (SPOP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  WB analysis using 68216-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68216-1-Ig (SPOP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

SPOP Monoclonal Antibody for WB, ELISA

Cat No. 68216-1-Ig

Clone No.2B9F2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, ELISA

Synonyms

HIB homolog 1, Roadkill homolog 1, speckle type POZ protein, SPOP, TEF2

---

Tested Applications

• Positive WB detected in: PC-3 cells, NCI-H1299 cells, U2OS cells, HCT-116 cells, HEK-293 cells, HeLa cells, K-562 cells, Jurkat cells, MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68216-1-Ig targets SPOP in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10384

  Product name: Recombinant human SPOP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-374 aa of BC003385

  Sequence: MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

• Full Name: speckle-type POZ protein
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC003385
• Gene Symbol: SPOP
• Gene ID (NCBI): 8405
• RRID: AB_2935304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43791
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SPOP (TEF2) protein was previously identified as an autoantigen in a patient with scleroderma pigmentosum. SPOP (speckle-type POZ protein), also known as TEF2, HIB homolog 1 or Roadkill homolog 1, is a member of the Tdpoz family containing one N-terminal MATH (Meprin and TRAF Homology) domain and one C-terminal BTB/POZ domain. SPOP can exist as a homodimer and is expressed in a variety of tissues localizing to the nucleus. BTB-mediated SPOP dimers form linear oligomers via BACK domain dimerization, and we determine the concentration-dependent populations of the resulting oligomeric species (PMID: 27220849 ). Through an interaction with CUL-3, SPOP is involved in ubiquitinylation and protein degradation. SPOP specifically interacts with CUL-3 via its BTB/POZ domain and recruits substrates to the CUL-3-based ubiquitin ligase via its MATH domain. Substrates recruited by SPOP and targeted for ubiquitylation via the CUL-3/SPOP complex include PDX-1, Bmi-1, MacroH2A, PIPK II ∫ and Daxx. These substrates are subsequently degraded by the proteasome. In addition, SPOP itself becomes ubiquitylated by the CUL-3-based ubiquitin ligase and is targeted for proteasomal degradation.