SPOP Monoclonal antibody

SPOP Monoclonal Antibody for WB, ELISA
Cat No. 68216-1-Ig
Clone No.2B9F2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, ELISA

HIB homolog 1, Roadkill homolog 1, speckle type POZ protein, SPOP, TEF2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-3 cells, NCI-H1299 cells, U2OS cells, HCT-116 cells, HEK-293 cells, HeLa cells, K-562 cells, Jurkat cells, MOLT-4 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68216-1-Ig targets SPOP in WB, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10384

Product name: Recombinant human SPOP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-374 aa of BC003385

Sequence: MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

Predict reactive species
Full Name speckle-type POZ protein
Calculated Molecular Weight 374 aa, 42 kDa
Observed Molecular Weight42 kDa
GenBank Accession NumberBC003385
Gene Symbol SPOP
Gene ID (NCBI) 8405
RRIDAB_2935304
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43791
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SPOP (TEF2) protein was previously identified as an autoantigen in a patient with scleroderma pigmentosum. SPOP (speckle-type POZ protein), also known as TEF2, HIB homolog 1 or Roadkill homolog 1, is a member of the Tdpoz family containing one N-terminal MATH (Meprin and TRAF Homology) domain and one C-terminal BTB/POZ domain. SPOP can exist as a homodimer and is expressed in a variety of tissues localizing to the nucleus. BTB-mediated SPOP dimers form linear oligomers via BACK domain dimerization, and we determine the concentration-dependent populations of the resulting oligomeric species (PMID: 27220849 ). Through an interaction with CUL-3, SPOP is involved in ubiquitinylation and protein degradation. SPOP specifically interacts with CUL-3 via its BTB/POZ domain and recruits substrates to the CUL-3-based ubiquitin ligase via its MATH domain. Substrates recruited by SPOP and targeted for ubiquitylation via the CUL-3/SPOP complex include PDX-1, Bmi-1, MacroH2A, PIPK II ∫ and Daxx. These substrates are subsequently degraded by the proteasome. In addition, SPOP itself becomes ubiquitylated by the CUL-3-based ubiquitin ligase and is targeted for proteasomal degradation.

Protocols

Product Specific Protocols
WB protocol for SPOP antibody 68216-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...