• Featured Product
  • KD/KO Validated

SQRDL Polyclonal antibody

SQRDL Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 17256-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IP, ELISA

CGI 44, CGI-44, EC:1.8.5.8, SQOR, Sulfide dehydrogenase-like

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HT-29 cells, HepG2 cells, THP-1 cells, HepG cells
Positive IP detected inHeLa cells
Positive IHC detected inmouse brain tissue, human colon cancer tissue, human liver cancer tissue, human lung tissue, human spleen tissue, human testis tissue, mouse liver tissue, rat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17256-1-AP targets SQRDL in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10762

Product name: Recombinant human SQRDL protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 100-450 aa of BC016836

Sequence: GRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

Predict reactive species
Full Name sulfide quinone reductase-like (yeast)
Calculated Molecular Weight 450 aa, 50 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC016836
Gene Symbol SQRDL
Gene ID (NCBI) 58472
RRIDAB_2195894
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y6N5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SQRDL(Sulfide:quinone oxidoreductase, mitochondrial) catalyzes the oxidation of hydrogen sulfide, with the help of a quinone.Although the SQRDL precursor protein displays a molecular weight of 50 kDa,a prominent band at about 46 kDa is detected by western blot. This discrepancy reflects the cleavage of an N-terminal targeting sequence of 4 kDa during the import of the protein into the mitochondria(PMID:22067608).SQRDL is one of the enzymes involved in H2S signaling in a discrete population of neurons, oligodendrocytes, and endothelial cells.

Protocols

Product Specific Protocols
IHC protocol for SQRDL antibody 17256-1-APDownload protocol
IP protocol for SQRDL antibody 17256-1-APDownload protocol
WB protocol for SQRDL antibody 17256-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell

Endogenous Hydrogen Sulfide Production Is Essential for Dietary Restriction Benefits.

Authors - Christopher Hine
  • KD Validated
rat,mouseWB

Nat Commun

Sulfide catabolism ameliorates hypoxic brain injury.

Authors - Eizo Marutani
  • KD Validated
mouseWB,IHC

Redox Biol

Sulfide:quinone oxidoreductase alleviates ferroptosis in acute kidney injury via ameliorating mitochondrial dysfunction of renal tubular epithelial cells

Authors - Fangfang Cai
mouseWB

EMBO Mol Med

β-RA reduces DMQ/CoQ ratio and rescues the encephalopathic phenotype in Coq9 R239X mice.

Authors - Agustín Hidalgo-Gutiérrez
humanWB

EMBO Mol Med

Coenzyme Q deficiency causes impairment of the sulfide oxidation pathway.

Authors - Marcello Ziosi
mouseWB

EMBO Mol Med

CoQ deficiency causes disruption of mitochondrial sulfide oxidation, a new pathomechanism associated with this syndrome.

Authors - Marta Luna-Sánchez
Loading...
||
New chat Able
正在加载,请稍候...