SR-BI Polyclonal antibody, PBS Only

• 

  WB analysis of human brain using 21277-1-AP (same clone as 21277-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21277-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21277-1-AP (same clone as 21277-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21277-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 21277-1-AP (same clone as 21277-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21277-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 21277-1-AP (same clone as 21277-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21277-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 21277-1-AP (same clone as 21277-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21277-1-AP (SR-BI antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21277-1-PBS in a different storage buffer formulation.

SR-BI Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21277-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

SCARB1, CD36, CD36 antigen-like 1, CLA 1, CLA1

---

Product Information

21277-1-PBS targets SR-BI in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15759

  Product name: Recombinant human SCARB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-230 aa of BC022087

  Sequence: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISR

• Full Name: scavenger receptor class B, member 1
• Calculated Molecular Weight: 552 aa, 61 kDa
• Observed Molecular Weight: 61-82 kDa
• GenBank Accession Number: BC022087
• Gene Symbol: SR-BI
• Gene ID (NCBI): 949
• RRID: AB_10858921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WTV0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.