SRBD1 Polyclonal antibody, PBS Only

• 

  WB analysis using 24931-1-AP (same clone as 24931-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 24931-1-AP (SRBD1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24931-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 24931-1-AP (same clone as 24931-1-PBS)

  IP result of anti-SRBD1 (IP:24931-1-AP, 4ug; Detection:24931-1-AP 1:300) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 24931-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 24931-1-AP (same clone as 24931-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24931-1-AP (SRBD1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24931-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 24931-1-AP (same clone as 24931-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24931-1-AP (SRBD1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24931-1-PBS in a different storage buffer formulation.

SRBD1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 24931-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

24931-1-PBS targets SRBD1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21661

  Product name: Recombinant human SRBD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 657-995 aa of BC032538

  Sequence: SIARRVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQDYIRTFCSQQTETSGQIQGVAVTSSADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFLSSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTDFDKPDFKRSIVCLEDLQIGTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKLSKTKKRRSLGLGPGERVEVQVLNIDIPRSRITLDLIRVL

• Full Name: S1 RNA binding domain 1
• Calculated Molecular Weight: 995 aa, 112 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC032538
• Gene Symbol: SRBD1
• Gene ID (NCBI): 55133
• RRID: AB_2879805
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5C6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

S1 RNA-binding domain-containing protein 1 (SRBD1) is a 995 amino acid protein, which contains one S1 motif domain. SRBD1 is a susceptibility gene for normal tension glaucoma (NTG) and may be involved in cell growth inhibition and apoptosis. Two isoforms of SRBD1 exist due to alternative splicing events, and the gene which encodes SRBD1 maps to human chromosome 2p21.