ST6GAL1 Polyclonal antibody

• 

  WB analysis using 34030-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34030-1-AP (ST6GAL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ST6GAL1 Polyclonal Antibody for WB, ELISA

Cat No. 34030-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Alpha 2,6-ST 1, B-cell antigen CD75, Beta-galactoside alpha-2,6-sialyltransferase 1, CD75, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1

---

Tested Applications

• Positive WB detected in: HCT 116 cells, mouse kindey tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34030-1-AP targets ST6GAL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg5252

  Product name: Recombinant rat ST6GAL1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-403 aa of NM_001113344.1

  Sequence: KKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

• Full Name: ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 43-45 kDa, 50-70 kDa
• GenBank Accession Number: NM_001113344.1
• Gene Symbol: ST6GAL1
• Gene ID (NCBI): 25197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P13721-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ST6GAL1 (β-galactoside α-2-6 sialyl transferase1; also known as ST6N or CD75) is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle. ST6GAL1 undergoes proteolytic process to generate soluble form from membrane form. Higher molecular weight of bands around 50-70 kDa can also be observed with glycosylation modification. (PMID: 15049997, 23358684)