ST8SIA3 Polyclonal antibody

• 

  WB analysis using 18004-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18004-1-AP (ST8SIA3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 18004-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18004-1-AP (ST8SIA3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 18004-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18004-1-AP (ST8SIA3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 18004-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 18004-1-AP (ST8SIA3 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 18004-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 18004-1-AP (ST8SIA3 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 18004-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 18004-1-AP (ST8SIA3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human skin using 18004-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 18004-1-AP (ST8SIA3 Antibody) at dilution of 1:200 (under 40x lens).

ST8SIA3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18004-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Alpha 2,8 sialyltransferase 8C, Sialyltransferase 8C, Sialytransferase St8Sia III, SIAT8 C, SIAT8C, ST8SIA3, ST8SiaIII

---

Tested Applications

• Positive WB detected in: A549 cells, mouse liver tissue, Caco-2 cells
• Positive IHC detected in: human liver tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

18004-1-AP targets ST8SIA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12497

  Product name: Recombinant human ST8SIA3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-380 aa of BC074909

  Sequence: SLISYVSLKKENIFTTPKYASPGAPRMYMFHAGFRSQFALKFLDPSFVPITNSLTQELQEKPSKWKFNRTAFLHQRQEILQHVDVIKNFSLTKNSVRIGQLMHYDYSSHKYVFSISNNFRSLLPDVSPIMNKHYNICAVVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFQRDVGRKTNLTTFNPSILEKYYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEHRGQLKVQLAWPGNIMQHVNRYWKNKHLSPKRLSTGILMYTLASAICEEIHLYGFWPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA

• Full Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3
• Calculated Molecular Weight: 380 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC074909
• Gene Symbol: ST8SIA3
• Gene ID (NCBI): 51046
• RRID: AB_2239838
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43173
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ST8 α-N-acetyl-neuraminide α-2,8-sialyltransferase (ST8Sia) family catalyzes the synthesis of one or multiple α2,8-linked sialic acid chains according to their acceptor specifificity (PMID:19888308). At least fifive ST8Sia enzymes (ST8SIA1, 2, 3, 4, and 6) have previously been identifified in adult brains (PMID:11530204). The ST8SIA3 is enriched in the striatum. The mouse St8sia3 gene shares 96% amino acid identity with human ST8SIA3, and is mainly expressed in the brain and testis (PMID:31455764).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Antiviral Res; Preventing human influenza and coronaviral mono or coinfection by blocking virus-induced sialylation; Authors - Md Ruhul Amin
rat	WB	J Adv Res; SA supplementation during lactation promotes learning and memory by reducing H3K27me3 levels; Authors - Chengqing Huang