STAMBP Polyclonal antibody

• 

  WB analysis using 11346-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11346-1-AP (STAMBP antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 11346-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11346-1-AP (STAMBP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 11346-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11346-1-AP (STAMBP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 11346-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11346-1-AP (STAMBP antibody) at dilution of 1:100 (under 10x lens).

• Featured Product
• KD/KO Validated

STAMBP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11346-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

AMSH, EC:3.4.19.-, Endosome-associated ubiquitin isopeptidase, STAM binding protein, STAM-binding protein

---

Tested Applications

• Positive WB detected in: Jurkat cells, human placenta tissue, mouse brain tissue, K-562 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

11346-1-AP targets STAMBP in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1895

  Product name: Recombinant human STAMBP protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 124-424 aa of BC007682

  Sequence: EKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

• Full Name: STAM binding protein
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC007682
• Gene Symbol: STAMBP
• Gene ID (NCBI): 10617
• RRID: AB_2197509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95630
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAM-binding protein (STAMBP) is also named AMSH. STAMBP, a member of the Jab1/MPN metalloenzyme family of deubiquitinating enzymes (DUBs), specifically cleaves K63-linked polyubiquitination chains from substrates (PMID: 15314065, PMID: 26601948). STAMBP is implicated in the endosome-lysosome pathway and shuttles ubiquitinated substrate proteins to lysosomes for degradation (PMID: 10383417, PMID: 24151880). STAMBP regulates protein degradation by binding to the ESCRT-0 protein STAM and the charged multivesicular body proteins of the ESCRT-III complex (PMID: 20159979). STAMBP is implicated in the inflammatory response by promoting the deubiquitination and stabilization of NALP7 and increasing the activity of inflammasomes (PMID: 28492230). STAMBP expression was increased in the cytoplasm of tumor cells from LUAD patients. STAMBP overexpression promoted cell migration and invasion, whereas STAMBP knockdown attenuated these processes in LUAD cells after epidermal growth factor treatment (PMID: 3410245).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; A phosphoinositide signalling pathway mediates rapid lysosomal repair; Authors - Jay Xiaojun Tan
human	WB,IHC,IF,CoIP	Cell Death Dis; Identification of STAM-binding protein as a target for the treatment of gemcitabine resistance pancreatic cancer in a nutrient-poor microenvironment; Authors - Wenming Zhang ; KD Validated
human	WB	J Biol Chem; Endosomal deubiquitinating enzymes control ubiquitination and down-regulation of protease-activated receptor 2.; Authors - Hasdemir Burcu B
human	WB	Mol Biol Cell; Arrestin-2 interacts with the endosomal sorting complex required for transport machinery to modulate endosomal sorting of CXCR4.; Authors - Malik Rohit R ; KD Validated