Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, A549 cells, K-562 cells, PC-3 cells |
| Positive IP detected in | PC-3 cells |
| Positive IHC detected in | human stomach tissue, human ovary cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | IFN alpha treated HeLa cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10144-2-AP targets STAT1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA, CUT&RUN applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, rabbit, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA Predict reactive species |
| Full Name | signal transducer and activator of transcription 1, 91kDa |
| Calculated Molecular Weight | 83 kDa |
| Observed Molecular Weight | 83-87 kDa |
| GenBank Accession Number | BC002704 |
| Gene Symbol | STAT1 |
| Gene ID (NCBI) | 6772 |
| RRID | AB_2286875 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42224 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
What is the molecular weight of STAT1? Are there any isoforms of STAT1? Is STAT1 post-translationally modified?
The molecular weight of STAT1 is 91 kDa for full-length STAT1α and 84 kDa for STAT1β, which is devoid of the C-terminal activation domain (PMID: 1502203). Phosphorylation of STAT1 regulates STAT1 activity. Phosphorylation of Tyr701 by Janus kinases (JAKs) triggers STAT1 homo- and hetero-dimerization with other STAT family members and also causes nuclear translocation, while phosphorylation of Ser727 is needed for full activation (PMID: 10851062). STAT1β lacks Ser727 and has therefore been considered to be inactive or acting in a dominant negative manner to STAT1α, although it has been further shown to be capable of transcription activation in vivo (PMID: 24710278).
What is the subcellular localization of STAT1?
STAT1 is present in the cytoplasm and in the nucleus. Translocation of STAT1 from the cytoplasm to the nucleus is required for its regulation of gene expression and is dependent on phosphorylation (see above). However, low levels of unphosphorylated STAT1, often referred to as U-STAT1, can also be found in the nucleus, where U-STAT1 regulates the stability of heterochromatin by binding to chromatin in monomeric or dimeric states (PMID: 18840523).
What is the tissue expression pattern of STAT1?
STAT1 is ubiquitously expressed.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for STAT1 antibody 10144-2-AP | Download protocol |
| IF protocol for STAT1 antibody 10144-2-AP | Download protocol |
| IHC protocol for STAT1 antibody 10144-2-AP | Download protocol |
| IP protocol for STAT1 antibody 10144-2-AP | Download protocol |
| WB protocol for STAT1 antibody 10144-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
STAT1 Polyclonal antibody (Cat# 10144-2-AP) has accumulated 296 citations across journals including Cell, Nature Communications, Immunity, Science Translational Medicine, The Journal of Clinical Investigation, Nature Microbiology, Cell Reports, and Redox Biology. Research fields span immunology, oncology, virology, inflammation, neuroscience, liver disease, nephrology, and pharmacology. Cited applications include WB, IF, IHC, IP, CoIP, ChIP, RIP, and CUT&RUN, with cross-reactivity demonstrated in human, mouse, rat, pig, monkey, rabbit, and chicken.
| Species | Application | Title |
|---|---|---|
Immunity Stepwise epigenetic signal integration drives adaptive programming of cytotoxic lymphocytes. | ||
Cancer Commun (Lond) MAGE-C3 promotes cancer metastasis by inducing epithelial-mesenchymal transition and immunosuppression in esophageal squamous cell carcinoma. | ||
Drug Resist Updat ITPKB suppresses ER calcium release to promote CXCL9 expression and enhance immunotherapy sensitivity in triple-negative breast cancer. | ||
Kidney Int Histone deacetylase 4 selectively contributes to podocyte injury in diabetic nephropathy. | ||
Bone Res Gut microbial metabolite targets HDAC3-FOXK1-interferon axis in fibroblast-like synoviocytes to ameliorate rheumatoid arthritis |
Reviews
What customers say
All five reviews are highly positive, with ratings of 4–5 stars. Users consistently report clear, specific bands at the expected molecular weight in Western Blot across diverse cell types including HeLa, A549 LUAD, liver cells, mouse embryonic fibroblasts, and SHED cell lines. One reviewer also confirmed strong, specific staining in immunofluorescence. Recommended dilutions ranged from 1/100 (IF) to 1/2000 (WB). Overall, customers describe the antibody as reliable and easy to use with minimal optimization needed.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
James (Verified Customer) (04-23-2026) | Worked pretty well.
![]() |
Margaux (Verified Customer) (10-25-2025) | I used this antibody to detect STAT1 protein in western-Blot (dilution 1/2000) in HeLa cells. It worked very well!
![]() |
Paul (Verified Customer) (11-24-2022) | Clear band at the expected size range
|
Alejandro (Verified Customer) (08-22-2022) | Works fine for both WB, with clear bands, and IF, which shows a high specific staining
|
Slavica (Verified Customer) (10-04-2021) | The antibody worked very well!!!
|

























