Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated STAT1 Polyclonal antibody

STAT1 Polyclonal Antibody for FC (Intra)

Cat No. CL488-10144

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

FC (Intra)

ISGF 3, Signal transducer and activator of transcription 1-alpha/beta, STAT91, Transcription factor ISGF-3 components p91/p84

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inMCF-7 cells, mouse Th1

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10144 targets STAT1 in FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0199

Product name: Recombinant human STAT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-230 aa of BC002704

Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA

Predict reactive species
Full Name signal transducer and activator of transcription 1, 91kDa
Calculated Molecular Weight 83 kDa
GenBank Accession NumberBC002704
Gene Symbol STAT1
Gene ID (NCBI) 6772
RRIDAB_2918956
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42224
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

What is the molecular weight of STAT1? Are there any isoforms of STAT1? Is STAT1 post-translationally modified?

The molecular weight of STAT1 is 91 kDa for full-length STAT1α and 84 kDa for STAT1β, which is devoid of the C-terminal activation domain (PMID: 1502203). Phosphorylation of STAT1 regulates STAT1 activity. Phosphorylation of Tyr701 by Janus kinases (JAKs) triggers STAT1 homo- and hetero-dimerization with other STAT family members and also causes nuclear translocation, while phosphorylation of Ser727 is needed for full activation (PMID: 10851062). STAT1β lacks Ser727 and has therefore been considered to be inactive or acting in a dominant negative manner to STAT1α, although it has been further shown to be capable of transcription activation in vivo (PMID: 24710278).

 What is the subcellular localization of STAT1?

STAT1 is present in the cytoplasm and in the nucleus. Translocation of STAT1 from the cytoplasm to the nucleus is required for its regulation of gene expression and is dependent on phosphorylation (see above). However, low levels of unphosphorylated STAT1, often referred to as U-STAT1, can also be found in the nucleus, where U-STAT1 regulates the stability of heterochromatin by binding to chromatin in monomeric or dimeric states (PMID: 18840523).

 What is the tissue expression pattern of STAT1?

STAT1 is ubiquitously expressed.


Protocols

Product Specific Protocols
FC protocol for CL Plus 488 STAT1 antibody CL488-10144Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...