STK17B Polyclonal antibody

• 

  WB analysis of A375 using 26600-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 26600-1-AP (STK17B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 26600-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26600-1-AP (STK17B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 26600-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26600-1-AP (STK17B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lymphoma using 26600-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26600-1-AP (STK17B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 26600-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26600-1-AP (STK17B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 26600-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26600-1-AP (STK17B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 26600-1-AP

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 26600-1-AP (STK17B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

STK17B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26600-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

DRAK2, serine/threonine kinase 17b, STK17B

---

Tested Applications

• Positive WB detected in: A375 cells, HepG2 cells, K-562 cells
• Positive IHC detected in: human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

26600-1-AP targets STK17B in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24389

  Product name: Recombinant human STK17B protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 250-372 aa of BC016040

  Sequence: VNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC

• Full Name: serine/threonine kinase 17b
• Calculated Molecular Weight: 372 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC016040
• Gene Symbol: STK17B
• Gene ID (NCBI): 9262
• RRID: AB_2880570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94768
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Serine/threonine kinase 17B (STK17B), also named as DRAK2, whose gene is located on chromosome 2 (2q32.3), was first reported by Sanjo et al. in 1998 (PMID: 9786912). STK17B has been identified as a promising therapeutic target for type 1 diabetes, multiple sclerosis, and graft rejection. There are also some reports demonstrated that STK17B was related to apoptosis in various cell types, such as islet β-cells and acute myeloid leukemia cells. Some researches revealed that STK17B was deregulated in some cancers and have important role in cancer progression (PMID: 29445189). It has an indispensable role in NAFLD/NASH and offer a potential therapeutic arget for this disease (PMID: 34614409).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cell Metab; DRAK2 aggravates nonalcoholic fatty liver disease progression through SRSF6-associated RNA alternative splicing.; Authors - Yufeng Li ; KO Validated
human	WB	Nat Immunol; A multi-kinase inhibitor screen identifies inhibitors preserving stem-cell-like chimeric antigen receptor T cells; Authors - Feifei Song