Tested Applications
Positive WB detected in | A375 cells, HepG2 cells, K-562 cells |
Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
26600-1-AP targets STK17B in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24389 Product name: Recombinant human STK17B protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 250-372 aa of BC016040 Sequence: VNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC Predict reactive species |
Full Name | serine/threonine kinase 17b |
Calculated Molecular Weight | 372 aa, 42 kDa |
Observed Molecular Weight | 42 kDa |
GenBank Accession Number | BC016040 |
Gene Symbol | STK17B |
Gene ID (NCBI) | 9262 |
RRID | AB_2880570 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O94768 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Serine/threonine kinase 17B (STK17B), also named as DRAK2, whose gene is located on chromosome 2 (2q32.3), was first reported by Sanjo et al. in 1998 (PMID: 9786912). STK17B has been identified as a promising therapeutic target for type 1 diabetes, multiple sclerosis, and graft rejection. There are also some reports demonstrated that STK17B was related to apoptosis in various cell types, such as islet β-cells and acute myeloid leukemia cells. Some researches revealed that STK17B was deregulated in some cancers and have important role in cancer progression (PMID: 29445189). It has an indispensable role in NAFLD/NASH and offer a potential therapeutic arget for this disease (PMID: 34614409).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for STK17B antibody 26600-1-AP | Download protocol |
IHC protocol for STK17B antibody 26600-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Metab DRAK2 aggravates nonalcoholic fatty liver disease progression through SRSF6-associated RNA alternative splicing.
| ||
Nat Immunol A multi-kinase inhibitor screen identifies inhibitors preserving stem-cell-like chimeric antigen receptor T cells |