Product Information
83077-4-PBS targets STT3A in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag31994 Product name: Recombinant human STT3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 550-600 aa of BC020965 Sequence: THISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV Predict reactive species |
| Full Name | STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) |
| Calculated Molecular Weight | 705 aa, 81 kDa |
| GenBank Accession Number | BC020965 |
| Gene Symbol | STT3A |
| Gene ID (NCBI) | 3703 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P46977 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

