Published Applications
| WB | See 1 publications below |
Product Information
27920-1-AP targets SUCNR1 in WB, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23819 Product name: Recombinant human SUCNR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 207-334 aa of BC030948 Sequence: YYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK Predict reactive species |
| Full Name | succinate receptor 1 |
| GenBank Accession Number | BC030948 |
| Gene Symbol | SUCNR1 |
| Gene ID (NCBI) | 56670 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BXA5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
